Property Summary

NCBI Gene PubMed Count 60
PubMed Score 79.41
PubTator Score 73.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 1.300 1.1e-05
astrocytic glioma 2.100 1.9e-03
ependymoma 1.700 7.8e-03
oligodendroglioma 2.600 1.2e-03
psoriasis -1.200 3.7e-09
osteosarcoma -2.172 2.0e-02
group 4 medulloblastoma -1.900 5.5e-07
atypical teratoid / rhabdoid tumor -1.400 5.5e-03
glioblastoma 1.200 2.7e-03
medulloblastoma, large-cell -1.800 1.5e-05
tuberculosis -1.500 4.6e-06
intraductal papillary-mucinous adenoma (... -1.700 2.5e-03
intraductal papillary-mucinous carcinoma... -1.300 1.2e-02
lung cancer 1.100 1.3e-02
interstitial cystitis 1.300 4.1e-03
adult high grade glioma -1.200 7.2e-04
Breast cancer -1.700 6.3e-07
progressive supranuclear palsy -1.100 6.5e-03
ovarian cancer 2.200 1.2e-03
pituitary cancer -1.700 1.1e-04
Down syndrome 1.200 4.9e-03
dermatomyositis 1.100 3.8e-03

Protein-protein Interaction (12)

Gene RIF (49)

PMID Text
26632716 LRIG1 expression was associated with pathological type, differentiation status, and stage of Non-small Cell Lung Cancer. The result showed that LRIG1 was an independent prognostic factor for OS of NSCLC patients.
26159916 LRIG1 is frequently methylated in human CRC and consequent mRNA and protein downregulation may contribute to tumor growth by activating EGFR/AKT signaling
26148232 ERa-dependent expression of LRIG1 dampens ErbB3 signaling in luminal breast cancer cells, and by blocking ERa activity with fulvestrant, LRIG1 is decreased thus permitting ErbB3 accumulation, enhanced ErbB3 signaling to cell survival pathways
25960225 MiR-20a mediated temozolomide-resistance in glioblastoma cells through negatively regulating LRIG1 expression.
25860915 The inhibitory effects of LRIG1 are most likely mediated by suppression of the EGFR/PI3K/AKT pathway and epithelial-mesenchymal transition (EMT) process.
25813475 These findings demonstrate that LRIG1 is an independent prognostic factor in patients with non-small cell lung cancer
25801120 Results showed that leucine-rich repeats and immunoglobulin-like domains can reverse multidrug resistance in glioblastoma, by negatively regulating epidermal growth factor receptor.
25794708 a subset of human duodenal tumors exhibited features of LRIG1(-/-) adenomas, including loss of LRIG1, gastric metaplasia (MUCIN5AC and MUCIN6), and increased amphiregulin and Egfr activity.
25695283 Based on these results, we concluded that the upregulation of LRIG1 expression inhibited the EGFR signaling pathway, activated the mitochondrial pathway of apoptosis and eventually increased the sensitivity of bladder cancer cells to CDDP.
25449296 LRIG1 can enhance chemosensitivity in glioblastoma by inhibition of BCL-2 and MnSOD
24879564 Loss of LRIG1 was independently associated with risk of any relapse.
24828152 USP8 is involved in deubiquitination of LRIG1, influencing the efficiency of Met degradation.
24709893 findings indicate that downregulation of LRIG1 is possibly a novel potential marker of transformation and tumorigenesis in OSSN cases.
24548859 LRIG1 immunoreactivity could be a clinically important prognostic marker in HPV-associated oropharyngeal cancer.
24314030 LRIG1 evolved in bladder cancer as a rare feedback negative attenuator of EGFR.
23850692 LRIG1 inhibits EGFR expression and the downstream signaling activation, interferes with Bcl-2/Topo-2 expressions and eventually sensitizes glioma cells to TMZ
23723069 Data indicate that Lrig3 opposes Lrig1 negative regulatory action and enhances ErbB receptors ERBB2, ERBB3 and ERBB4 stability.
23624915 LRIG1 downregulation in cancer cells enhances EGFR-MAPK-SPHK1 signaling and ECM remodeling activity, leading to malignant phenotypes of head and neck cancers
23581227 These findings suggest that upregulation of LRIG1 expression enhances the CDDP sensitivity in the glioma cell line U251.
23208928 LRIG1 Loss of heterozygosity (LOH) is frequent across cancers and its loss is an early event in the development of human squamous carcinomas.
23208509 LRIG1 mediates degradation of Met by SAIT301 and this degradation does not require Met activation.
23165628 High LRIG1 expression is associated with cervical adenocarcinoma progression.
23124613 Downregulation of LRIG1 expression promotes the aggressive properties of glioma cells via EGFR/Akt/c-Myc activation.
22554477 This study revealed that the previously described up-regulation of EGFR and down-regulation of ERBB4 occurred in all analyzed renal cell carcinoma types, whereas down-regulation of ERBB2 and LRIG1 was only present in clear cell renal cell carcinoma.
22528225 These findings suggested that LRIG1-targeting siRNA can exert a dramatically inhibitory effect on RNA transcription and protein expression of LRIG1.
22484910 Cytoplasmic expression of LRIG1 is associated with meningiomas.
22464327 Observations suggest the tumor suppressor function of LRIG1 is lost in a subset of colorectal cancers.
22241084 our findings show that both upregulation of RTK signaling and attenuated TNFalpha expression caused by LRIG1 downregulation confers resistance to Smac mimetics
21821674 ErbB2 activation antagonizes ERalpha-driven Lrig1 expression, providing a mechanistic explanation for Lrig1 loss in ErbB2-positive breast cancer. This work provides strong evidence for a growth-inhibitory role for Lrig1 in breast cancer.
21632100 LRIG1 and LRIG2 expressions were seen in precancerous cervical epithelium and found to increase with increasing grade.
21431282 LRIG1-transduced cells treated with cisplatin had more severe DNA damage, cellular apoptosis, growth inhibition and reversal of invasion
21128282 LRIG1 was a marker for good prognosis after prostatectomy, which might be due to its growth inhibiting properties
21087604 the LRIG1 ectodomain can be proteolytically shed and can function as a non-cell-autonomous regulator of growth factor signaling
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19490591 ERBB2 and LRIG1 copy number is increased in breast cancer
19300910 Down-regulation of LRIG1 is associated with malignant glioma.
18922900 Suppression of the negative regulator LRIG1 contributes to ErbB2 overexpression in breast cancer.
18542056 loss of LRIG1 in tumors may contribute to a permissive environment for EGFRvIII overexpression, contributing to EGFRvIII oncogenesis.
18037903 LRIG proteins may have a role in epidermal homeostasis and psoriasis
17851870 Great heterogeneity in the expression of the LRIG1 protein in colorectal cancer, which was not related to gene dosage of the LRIG1 gene.
17624990 a role of LRIG1 in tumor suppression in the uterine cervix
17178829 LRIG1 is a novel negative regulator of the Met receptor and opposes Met and Her2 synergy.
16877544 Lrig1 maintains epidermal stem cells in a quiescent nondividing state, and Lrig1 down-regulation triggers proliferation
16168117 A breast cancer linked gene is located within an amplicon containing the LRIG1 locus at 3p14.3.
15345710 LRIG1-mediated receptor ubiquitination and degradation may contribute to the suppression of ErbB receptor function
15282549 LRIG1 evolved in mammals as a feedback negative attenuator of signaling by receptor tyrosine kinases
14520461 downregulation of LRIG1 is associated with renal cell carcinoma
12684867 Results demonstrate that LRIG1 is an integral cell-surface membrane protein that is expressed by specific cells in various human tissues and that its 143-kDa form might be cleaved into 111-kDa and 32-kDa fragments.
12234026 Down-regulation of LIG-1 is associated with cancer

AA Sequence

MARPVRGGLGAPRRSPCLLLLWLLLLRLEPVTAAAGPRAPCAAACTCAGDSLDCGGRGLAALPGDLPSWT      1 - 70
RSLNLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSLFLQHNKIRSVEGSQLKAYLS     71 - 140
LEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLELGAFDGLSRSLLTLRLSKNRITQLPVRAFKL    141 - 210
PRLTQLDLNRNRIRLIEGLTFQGLNSLEVLKLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLY    211 - 280
GLTALHQLHLSNNSIARIHRKGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGA    281 - 350
FKGLRSLRVLDLDHNEISGTIEDTSGAFSGLDSLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGGNAIRS    351 - 420
VQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLIGRMLQAFVTATCAHPESLKGQSIFSVPPESFVCD    421 - 490
DFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFAWKKDNEVLTNADMENFVHVHAQDGEVMEYTT    491 - 560
ILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLTVNVLPSFTKTPHDITIRTTTMARLECAATGHPNPQI    561 - 630
AWQKDGGTDFPAARERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVLETPSLVVPLE    631 - 700
DRVVSVGETVALQCKATGNPPPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLG    701 - 770
TERAHSQLSVLPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETVVPPDVP    771 - 840
SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAGSAYHKEPWKA    841 - 910
MEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYSRGQAFHPQPVSRDSAQPSAPNGPEPGGSDQEHSPHHQC    911 - 980
SRTAAGSCPECQGSLYPSNHDRMLTAVKKKPMASLDGKGDSSWTLARLYHPDSTELQPASSLTSGSPERA    981 - 1050
EAQYLLVSNGHLPKACDASPESTPLTGQLPGKQRVPLLLAPKS                              1051 - 1093
//

Text Mined References (61)

PMID Year Title
26632716 2015 Expression of LRIG1 is Associated With Good Prognosis for Human Non-small Cell Lung Cancer.
26159916 2015 LRIG1, a 3p tumor suppressor, represses EGFR signaling and is a novel epigenetic silenced gene in colorectal cancer.
26148232 2016 Decreased LRIG1 in fulvestrant-treated luminal breast cancer cells permits ErbB3 upregulation and increased growth.
25960225 2015 miR-20a mediates temozolomide-resistance in glioblastoma cells via negatively regulating LRIG1 expression.
25860915 2015 LRIG1 inhibits hypoxia-induced vasculogenic mimicry formation via suppression of the EGFR/PI3K/AKT pathway and epithelial-to-mesenchymal transition in human glioma SHG-44 cells.
25813475 2015 LRIG1 is a prognostic biomarker in non-small cell lung cancer.
25801120 2015 LRIG1, human EGFR inhibitor, reverses multidrug resistance through modulation of ABCB1 and ABCG2.
25794708 2015 Loss of Lrig1 leads to expansion of Brunner glands followed by duodenal adenomas with gastric metaplasia.
25695283 2015 Adenovirus-mediated LRIG1 expression enhances the chemosensitivity of bladder cancer cells to cisplatin.
25449296 2015 LRIG1 improves chemosensitivity through inhibition of BCL-2 and MnSOD in glioblastoma.
24879564 2014 Loss of LRIG1 locus increases risk of early and late relapse of stage I/II breast cancer.
24828152 2014 USP8 modulates ubiquitination of LRIG1 for Met degradation.
24709893 2014 LRIG1 as a potential novel marker for neoplastic transformation in ocular surface squamous neoplasia.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24548859 2014 Expression of LRIG1 is associated with good prognosis and human papillomavirus status in oropharyngeal cancer.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24314030 2013 Restoration of LRIG1 suppresses bladder cancer cell growth by directly targeting EGFR activity.
23850692 2013 LRIG1 dictates the chemo-sensitivity of temozolomide (TMZ) in U251 glioblastoma cells via down-regulation of EGFR/topoisomerase-2/Bcl-2.
23723069 2013 Leucine-rich repeat and immunoglobulin domain-containing protein-1 (Lrig1) negative regulatory action toward ErbB receptor tyrosine kinases is opposed by leucine-rich repeat and immunoglobulin domain-containing protein 3 (Lrig3).
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23624915 2014 LRIG1 modulates aggressiveness of head and neck cancers by regulating EGFR-MAPK-SPHK1 signaling and extracellular matrix remodeling.
23581227 2012 LRIG1 enhances cisplatin sensitivity of glioma cell lines.
23208928 2013 LRIG1 regulates cadherin-dependent contact inhibition directing epithelial homeostasis and pre-invasive squamous cell carcinoma development.
23208509 2014 Cbl-independent degradation of Met: ways to avoid agonism of bivalent Met-targeting antibody.
23165628 2013 Expression of LRIG1 and LRIG3 correlates with human papillomavirus status and patient survival in cervical adenocarcinoma.
23124613 2013 Downregulation of LRIG1 expression by RNA interference promotes the aggressive properties of glioma cells via EGFR/Akt/c-Myc activation.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22554477 2012 Gene expression pattern of the epidermal growth factor receptor family and LRIG1 in renal cell carcinoma.
22528225 2012 Effects of RNAi-mediated gene silencing of LRIG1 on proliferation and invasion of glioma cells.
22484910 2012 Immunohistochemical analysis of LRIG proteins in meningiomas: correlation between estrogen receptor status and LRIG expression.
22464327 2012 The pan-ErbB negative regulator Lrig1 is an intestinal stem cell marker that functions as a tumor suppressor.
22241084 2012 LRIG1 modulates cancer cell sensitivity to Smac mimetics by regulating TNF? expression and receptor tyrosine kinase signaling.
21909108 2011 Meta-analysis of genome-wide association studies from the CHARGE consortium identifies common variants associated with carotid intima media thickness and plaque.
21821674 2011 Lrig1 is an estrogen-regulated growth suppressor and correlates with longer relapse-free survival in ER?-positive breast cancer.
21632100 2011 Correlation between LRIG1 and LRIG2 expressions and expression of 11 tumor markers, with special reference to tumor suppressors, in CIN and normal cervical epithelium.
21431282 2011 LRIG1 combined with cisplatin enhances bladder cancer lesions via a novel pathway.
21128282 2011 LRIG1 and the liar paradox in prostate cancer: a study of the expression and clinical significance of LRIG1 in prostate cancer.
21087604 2011 Paracrine regulation of growth factor signaling by shed leucine-rich repeats and immunoglobulin-like domains 1.
21076409 2010 Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19490591 2009 Co-incidental increase in gene copy number of ERBB2 and LRIG1 in breast cancer.
19300910 2009 Upregulation of LRIG1 suppresses malignant glioma cell growth by attenuating EGFR activity.
18922900 2008 Suppression of the negative regulator LRIG1 contributes to ErbB2 overexpression in breast cancer.
18542056 2008 LRIG1 negatively regulates the oncogenic EGF receptor mutant EGFRvIII.
18037903 2008 Redistribution of LRIG proteins in psoriasis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17851870 2007 LRIG1 expression in colorectal cancer.
17624990 LRIG1 and squamous epithelial uterine cervical cancer: correlation to prognosis, other tumor markers, sex steroid hormones, and smoking.
17178829 2007 LRIG1 is a novel negative regulator of the Met receptor and opposes Met and Her2 synergy.
16877544 2006 Single-cell expression profiling of human epidermal stem and transit-amplifying cells: Lrig1 is a regulator of stem cell quiescence.
16168117 2005 Increased copy number at 3p14 in breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345710 2004 The leucine-rich repeat protein LRIG1 is a negative regulator of ErbB family receptor tyrosine kinases.
15282549 2004 LRIG1 restricts growth factor signaling by enhancing receptor ubiquitylation and degradation.
14520461 2003 LRIG1 and epidermal growth factor receptor in renal cell carcinoma: a quantitative RT--PCR and immunohistochemical analysis.
12684867 2003 LRIG1 protein in human cells and tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234026 2002 Is LRIG1 a tumour suppressor gene at chromosome 3p14.3?
12067728 2002 Targeted disruption of LIG-1 gene results in psoriasiform epidermal hyperplasia.
11414704 2001 Cloning, characterization, and expression of human LIG1.
8798419 1996 cDNA cloning of a novel membrane glycoprotein that is expressed specifically in glial cells in the mouse brain. LIG-1, a protein with leucine-rich repeats and immunoglobulin-like domains.