Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.94
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.700 1.8e-03
hepatocellular carcinoma 1.900 4.4e-06
pancreatic cancer 1.200 2.3e-02
osteosarcoma 2.304 3.8e-04
adrenocortical carcinoma 1.293 5.8e-05
tuberculosis and treatment for 6 months -2.100 1.7e-04
intraductal papillary-mucinous neoplasm ... 2.100 3.8e-04
pancreatic carcinoma 1.200 2.3e-02
aldosterone-producing adenoma -1.348 1.2e-02
lung adenocarcinoma 1.106 1.4e-05
spina bifida -2.155 3.0e-02
ovarian cancer 1.200 1.9e-02

Gene RIF (3)

PMID Text
23542155 Thus, the molecular network involving HBiX1 (previously termed C1orf103) and SMCHD1 links the H3K9me3 and XIST-H3K27me3 domains to organize the compact inactive X chromosome structure.
18187620 Knockdown of ligand dependent nuclear receptor interacting factor 1 (LRIF1; C1orf103) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17455211 RIF1 is a novel nuclear matrix transcription repressor: a potential role of RIF1 regulation of nuclear receptor transcriptional activity.

AA Sequence

MSNNLRRVFLKPAEENSGNASRCVSGCMYQVVQTIGSDGKNLLQLLPIPKSSGNLIPLVQSSVMSDALKG      1 - 70
NTGKPVQVTFQTQISSSSTSASVQLPIFQPASSSNYFLTRTVDTSEKGRVTSVGTGNFSSSVSKVQSHGV     71 - 140
KIDGLTMQTFAVPPSTQKDSSFIVVNTQSLPVTVKSPVLPSGHHLQIPAHAEVKSVPASSLPPSVQQKIL    141 - 210
ATATTSTSGMVEASQMPTVIYVSPVNTVKNVVTKNFQNIYPKPVTEIAKPVILNTTQIPKNVATETQLKG    211 - 280
GQHSQAAPVKWIFQDNLQPFTPSLVPVKSSNNVASKILKTFVDRKNLGDNTINMPPLSTIDPSGTRSKNM    281 - 350
PIKDNALVMFNGKVYLLAKKGTDVLPSQIDQQNSVSPDTPVRKDTLQTVSSSPVTEISREVVNIVLAKSK    351 - 420
SSQMETKSLSNTQLASMANLRAEKNKVEKPSPSTTNPHMNQSSNYLKQSKTLFTNPIFPVGFSTGHNAPR    421 - 490
KVTAVIYARKGSVLQSIEKISSSVDATTVTSQQCVFRDQEPKIHNEMASTSDKGAQGRNDKKDSQGRSNK    491 - 560
ALHLKSDAEFKKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGERKQQNFDKKR    561 - 630
KAKTNKKMDHIKKRKTENAYNAIINGEANVTGSQLLSSILPTSDVSQHNILTSHSKTRQEKRTEMEYYTH    631 - 700
EKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVTPPELEETIRDEKIRRLKQVLREKEAALEEMRKKMHQK     701 - 769
//

Text Mined References (23)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23542155 2013 Human inactive X chromosome is compacted through a PRC2-independent SMCHD1-HBiX1 pathway.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21888893 2011 Analysis of the human HP1 interactome reveals novel binding partners.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17455211 2007 RIF-1, a novel nuclear receptor corepressor that associates with the nuclear matrix.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.