Property Summary

NCBI Gene PubMed Count 41
PubMed Score 124.19
PubTator Score 68.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.153 1.7e-06
pancreatic ductal adenocarcinoma liver m... -4.498 2.9e-04
tuberculosis and treatment for 3 months -1.100 1.7e-02
breast carcinoma 1.700 3.8e-04
psoriasis 2.200 5.7e-61
ductal carcinoma in situ 1.200 1.3e-02
ulcerative colitis 1.100 1.4e-03
head and neck cancer 1.600 1.0e-04

Gene RIF (26)

PMID Text
26856989 Results provided evidence for LRG1 function as a novel inducer of epithelial-mesenchymal transition and angiogenesis in colorectal cancer, which was at least partially through promotion of HIF-1alpha expression.
26517349 Data show that leucine-rich-alpha-2-glycoprotein 1 (LRG1) is markedly up-regulated and serves as an independent factor of poor outcomes in hepatocellular carcinoma (HCC).
26448929 Reanalysis of a total of 47 MDS patients revealed biomarker candidates, with alpha-2-HS-glycoprotein and leucine-rich alpha-2-glycoprotein as the most promising candidates.
26425690 Two of these proteins were verified in a separate patient cohort: values of CRP and LRG1 combined gave a highly significant indication of extended survival post one week of radiotherapy treatment.
26049667 Findings suggest that LRG1 promotes invasion and migration of glioma cells through TGF-beta signaling pathway.
25814288 LGR1 is involved in the inhibition of HCC metastasis.
25799488 Data found LRG1 as a promising candidate marker for detection of epithelial ovarian cancer (EOC) and the combination of LRG1 and CA125 showed improved performance to distinguish EOC including early stage EOC from non-cases compared to CA125.
25636050 Higher LRG1 is a significant predictor for arterial stiffness, endothelial function, and peripheral arterial disease.
25589464 silencing the expression of LRG1 suppresses the growth of glioblastoma U251 cells in vitro and in vivo, suggesting that LRG1 may play a critical role in glioblastoma development, and it may have potential clinical implications in glioblastoma therapy.
25277046 The blood proteins IGF1, IGF2, IBP2, IBP3 and A2GL have been proposed as indirect biomarkers for detection of GH administration and as putative biomarkers for breast cancer diagnosis.
25058884 Results suggest that serum LRG-1 is a promising biomarker for pancreatic cancer.
24760273 LRG1 potentially offered clinical value in directing personal treatment for endometrial carcinoma patients
24058569 Human LRG (hLRG) concentration in the cerebrospinal fluid (CSF) was measured and hLRG expression in post-mortem human cerebral cortex and mouse LRG (mLRG) in the brain were examined.
23284758 Overexpression of serum LRG1 is associated with non-small cell lung cancer.
22374925 High Serum leucine-rich alpha-2 glycoprotein is associated with ulcerative colitis.
22277732 Increased plasma levels of the APC-interacting protein MAPRE1, LRG1, and IGFBP2 precede a diagnosis of colorectal cancer in women
22116432 This study demonistrated that LRG expression in resident astrocytes increased with age.
21557262 Screened for NSCLC-related proteins in urinary exosomes by comparing urinary exosomes proteome of normal controls and NSCLC patients. The LRG1 was found to be expressed at higher levels in urinary exosomes and lung tissue of NSCLC patients.
21282491 LRG1 was identified as a serum biomarker that accurately identifies patients with heart failure.
20442399 autologous Cyt c is an endogeneous ligand for LRG and PLIbeta and these serum proteins neutralize the autologous Cyt c released from the dead cells
19851871 Serum LRG when bound to extracellular Cyt c that is released from apoptotic cells acts as a survival factor for lymphocytes and possibly other cells that are susceptible to the toxic effect of extracellular Cyt c.
19324010 These results strongly suggest that LRG was a secretory type 1 acute-phase protein whose expression was up-regulated by the mediator of acute-phase response.
17583700 Several indirect lines of evidence suggest a role for LRG in implantation/decidualization.
17194537 These results also indicate that the CSF level assay of TGF-beta1, TbetaR-II and LRG is useful for the diagnosis of patients with INPH, and TGF-beta1, TbetaR-II and LRG may be involved in the pathogenesis of the disease.
16699948 Mass spectrometry analysis identified the serum inhibitory factor as leucine-rich alpha-2-glycoprotein-1 in enzyme-linked immunosorbent assay .
12223515 cDNA clones for human leucine-rich alpha2-glycoprotein were isolated. LRG expression was up-regulated during neutrophil differentiation but down-regulated during monocytic differentiation. The hLRG gene was localized to chromosome 19p13.3.

AA Sequence

MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADT      1 - 70
VHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASA     71 - 140
TLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRG    141 - 210
PLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLW    211 - 280
ASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ       281 - 347
//

Text Mined References (45)

PMID Year Title
26856989 2016 LRG1 modulates epithelial-mesenchymal transition and angiogenesis in colorectal cancer via HIF-1? activation.
26517349 2015 LRG1 expression indicates unfavorable clinical outcome in hepatocellular carcinoma.
26448929 2015 Plasma Protein Biomarker Candidates for Myelodysplastic Syndrome Subgroups.
26425690 2015 Discovery and Validation of Predictive Biomarkers of Survival for Non-small Cell Lung Cancer Patients Undergoing Radical Radiotherapy: Two Proteins With Predictive Value.
26049667 2015 LRG1 modulates invasion and migration of glioma cell lines through TGF-? signaling pathway.
25814288 2015 LRG1 suppresses the migration and invasion of hepatocellular carcinoma cells.
25799488 2015 Validation of LRG1 as a potential biomarker for detection of epithelial ovarian cancer by a blinded study.
25636050 2015 Elevation of a novel angiogenic factor, leucine-rich-?2-glycoprotein (LRG1), is associated with arterial stiffness, endothelial dysfunction, and peripheral arterial disease in patients with type 2 diabetes.
25589464 2015 Stable knockdown of LRG1 by RNA interference inhibits growth and promotes apoptosis of glioblastoma cells in vitro and in vivo.
25277046 2015 Targeted mass spectrometry analysis of the proteins IGF1, IGF2, IBP2, IBP3 and A2GL by blood protein precipitation.
25058884 2015 Clinicopathological Significance of Leucine-Rich ?2-Glycoprotein-1 in Sera of Patients With Pancreatic Cancer.
24760273 2014 LRG1 is an independent prognostic factor for endometrial carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24058569 2013 Leucine-rich ?2-glycoprotein is a novel biomarker of neurodegenerative disease in human cerebrospinal fluid and causes neurodegeneration in mouse cerebral cortex.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23284758 2012 Integrative proteomics and tissue microarray profiling indicate the association between overexpressed serum proteins and non-small cell lung cancer.
22374925 2012 Serum leucine-rich alpha-2 glycoprotein is a disease activity biomarker in ulcerative colitis.
22277732 2012 Increased plasma levels of the APC-interacting protein MAPRE1, LRG1, and IGFBP2 preceding a diagnosis of colorectal cancer in women.
22116432 2012 Brain localization of leucine-rich ?2-glycoprotein and its role.
21557262 2011 Proteomic identification of exosomal LRG1: a potential urinary biomarker for detecting NSCLC.
21282491 2011 Proteomic analysis of coronary sinus serum reveals leucine-rich ?2-glycoprotein as a novel biomarker of ventricular dysfunction and heart failure.
20442399 2010 Autologous extracellular cytochrome c is an endogenous ligand for leucine-rich alpha2-glycoprotein and beta-type phospholipase A2 inhibitor.
20363744 2010 Prolyl 3-hydroxylase 1 null mice display abnormalities in fibrillar collagen-rich tissues such as tendons, skin, and bones.
19851871 2010 Cytochrome c-induced lymphocyte death from the outside in: inhibition by serum leucine-rich alpha-2-glycoprotein-1.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19324010 2009 Up-regulation of the expression of leucine-rich alpha(2)-glycoprotein in hepatocytes by the mediators of acute-phase response.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17583700 2008 Specific isoforms of leucine-rich alpha2-glycoprotein detected in the proliferative endometrium of women undergoing assisted reproduction are associated with spontaneous pregnancy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17194537 2007 Expression of TGF-betas and TGF-beta type II receptor in cerebrospinal fluid of patients with idiopathic normal pressure hydrocephalus.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16699948 2006 Serum leucine-rich alpha-2-glycoprotein-1 binds cytochrome c and inhibits antibody detection of this apoptotic marker in enzyme-linked immunosorbent assay.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12223515 2002 Molecular characterization and expression analysis of leucine-rich alpha2-glycoprotein, a novel marker of granulocytic differentiation.
11801638 2002 Gene expression profiling of mucosal addressin cell adhesion molecule-1+ high endothelial venule cells (HEV) and identification of a leucine-rich HEV glycoprotein as a HEV marker.
3856868 1985 Periodicity of leucine and tandem repetition of a 24-amino acid segment in the primary structure of leucine-rich alpha 2-glycoprotein of human serum.