Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -2.000 2.9e-02
cystic fibrosis 2.691 2.8e-06
group 4 medulloblastoma 1.500 4.3e-04
invasive ductal carcinoma -1.100 8.6e-03
lung adenocarcinoma -1.900 6.5e-20
non-small cell lung cancer -1.062 7.9e-16
ovarian cancer -1.700 1.5e-03

Synonym

Accession Q5VUJ6 F5H2T1 Q08AD5 Q9HA88 Q9P233
Symbols dA204F4.4

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

MAASQGGGGNSGGGGCGGGGSSGGCGTAGGGGGGAGGGGGGGGGTLVVPIPVPTLFGQPFPNGPPWNPGS      1 - 70
LQPQHTVRSLDRALEEAGSSGILSLSGRKLRDFPGSGYDLTDTTQADLSRNRFTEIPSDVWLFAPLETLN     71 - 140
LYHNCIKTIPEAIKNLQMLTYLNISRNLLSTLPKYLFDLPLKVLVVSNNKLVSIPEEIGKLKDLMELDIS    141 - 210
CNEIQVLPQQMGKLHSLRELNIRRNNLHVLPDELGDLPLVKLDFSCNKVTEIPVCYRKLHHLQVIILDNN    211 - 280
PLQVPPAQICLKGKVHIFKYLNIQACCRMDKKPDSLDLPSLSKRMPSQPLTDSMEDFYPNKNHGPDSGIG    281 - 350
SDNGEKRLSTTEPSDDDTVSLHSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQG    351 - 420
NAHIGSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQLLQQEQKNRIL    421 - 490
NHSTSVMRNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIR    491 - 560
KEYFKYKSMRKSSSGNENDEQDSDNANMSTQSPVSSEEYDRTDGFSHSPFGLKPRSAFSRSSRQEYGAAD    561 - 630
PGFTMRRKMEHLREEREQIRQLRNNLESRLKVILPDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAV    631 - 700
PKLSMAKCRRNVENFLDACKKLGVSQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSVA         701 - 765
//

Text Mined References (9)

PMID Year Title