Property Summary

NCBI Gene PubMed Count 30
PubMed Score 158.86
PubTator Score 14.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.900 1.1e-06
cutaneous lupus erythematosus 1.400 2.5e-03
osteosarcoma -1.210 1.7e-02
cystic fibrosis 3.996 1.6e-07
astrocytoma 1.500 1.9e-02
glioblastoma 1.500 5.6e-03
tuberculosis and treatment for 6 months -2.300 1.6e-05
non-small cell lung cancer -1.660 1.9e-12
colon cancer -1.900 4.8e-02
lung cancer -2.800 9.8e-06
interstitial cystitis 1.600 4.2e-03
adult high grade glioma 1.100 1.4e-03
pilocytic astrocytoma 1.200 1.1e-07
primary Sjogren syndrome 1.700 4.3e-04
subependymal giant cell astrocytoma 1.346 2.1e-02
invasive ductal carcinoma 1.200 9.9e-04
lung carcinoma -1.400 1.3e-18
ductal carcinoma in situ 1.300 9.3e-04
ulcerative colitis 1.200 5.9e-03
ovarian cancer -1.300 1.2e-06

Gene RIF (14)

PMID Text
26866573 The full-length leupaxin binds to the Pyk2-focal adhesion targeting domain.
26079947 Authors demonstrate that LPXN directly influences cytoskeletal dynamics via interaction with the actin-binding protein CaD and regulates CaD phosphorylation by recruiting ERK to highly dynamic structures within PCa cells.
25955236 Results show that leupaxin has particular influence on the progression and invasion of breast cancer cells and may therefore represent an interesting candidate protein for diagnosis and therapeutic interventions.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20543562 first evidence of dynamic regulation of leupaxin localization and tyrosine phosphorylation by G-Protein Coupled Receptors
19917054 leupaxin functions as a paxillin counterpart that potently suppresses the tyrosine phosphorylation of paxillin during integrin signaling.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760607 LPXN, a member of the paxillin superfamily, is fused to RUNX1 in an acute myeloid leukemia patient with a t(11;21)(q12;q22) translocation.
18497331 Leupaxin is enriched in vascular smooth nuscle. It undergoes cytoplasmic/nuclear shuttling & functions as an serum response factor cofactor. It associates with CArG-containing regions. Its ectopic expression induces smooth muscle marker gene expression.
18451096 leupaxin could serve as a potential progression marker for a subset of PCa and may represent a novel coactivator of the androgen receptor
17640867 Leupaxin plays an inhibitory role in BCR signaling and B cell function.
17329398 These data demonstrate that LPXN forms a signaling complex with Pyk2, c-Src, and PTP-PEST to regulate migration of prostate cancer cells.
15786712 Leupaxin binding to tyrosine phosphatase PEP suggests that leupaxin may function as a signal-transducing complex with PEP.
12674328 leupaxin may be a critical nucleating component of the osteoclast podosomal signaling complex

AA Sequence

MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELN      1 - 70
VYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQ     71 - 140
DLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPR    141 - 210
CAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN    211 - 280
YLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHP    281 - 350
EHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL                                      351 - 386
//

Text Mined References (37)

PMID Year Title
26866573 2016 Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
26079947 2015 Leupaxin stimulates adhesion and migration of prostate cancer cells through modulation of the phosphorylation status of the actin-binding protein caldesmon.
25955236 2015 Leupaxin is expressed in mammary carcinoma and acts as a transcriptional activator of the estrogen receptor ?.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20543562 Leupaxin is similar to paxillin in focal adhesion targeting and tyrosine phosphorylation but has distinct roles in cell adhesion and spreading.
19946888 2010 Defining the membrane proteome of NK cells.
19917054 2010 LIM domain-containing adaptor, leupaxin, localizes in focal adhesion and suppresses the integrin-induced tyrosine phosphorylation of paxillin.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19760607 2009 LPXN, a member of the paxillin superfamily, is fused to RUNX1 in an acute myeloid leukemia patient with a t(11;21)(q12;q22) translocation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18497331 2008 The LIM protein leupaxin is enriched in smooth muscle and functions as an serum response factor cofactor to induce smooth muscle cell gene transcription.
18451096 2008 Leupaxin, a novel coactivator of the androgen receptor, is expressed in prostate cancer and plays a role in adhesion and invasion of prostate carcinoma cells.
17640867 2007 Leupaxin negatively regulates B cell receptor signaling.
17329398 2007 Interaction of Pyk2 and PTP-PEST with leupaxin in prostate cancer cells.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15786712 2005 Leupaxin binds to PEST domain tyrosine phosphatase PEP.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12674328 2003 Leupaxin is a critical adaptor protein in the adhesion zone of the osteoclast.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10604475 1999 Binding of paxillin to alpha4 integrins modifies integrin-dependent biological responses.
9565592 1998 Leupaxin is a novel LIM domain protein that forms a complex with PYK2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.