Property Summary

NCBI Gene PubMed Count 63
PubMed Score 520.62
PubTator Score 45.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Leukemia, Acute Myeloid 17

Expression

Gene RIF (26)

PMID Text
26028032 alteration of LPP expression markedly changes the collectiveness and metastatic potential of cancer cells
25279986 3q28 rs6444305 in LPP gene is associated with follicular lymphoma.
24334606 Results suggest that rs4686484 is the functional variant in this locus, while LPP expression is decreased in CeD.
23447672 interaction between LPP and alpha-actinin, an actin cross-linking protein, is necessary for TGFbeta-induced migration and invasion of ErbB2-expressing breast cancer cells.
23056290 Three polymorphisms of LPP gene were selected and replicated in additional 1132 PCOS cases and 1142 controls. Our results suggest that LPP gene might be a novel candidate for PCOS
22639458 The results suggest that genomic alterations and clearly deleterious sequence changes in the LPP gene are not a common cause of esophageal atresia/tracheoesophageal fistula or VACTERL association.
22404213 Knockdown of LIM domain containing preferred translocation partner in lipoma (LPP) by siRNA enhances HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
20949626 haploinsufficiency of LPP may be a novel cause of conotruncal cardiac anomalies, particularly forms of tetralogy of Fallot
20647273 Observational study of gene-disease association. (HuGE Navigator)
20410501 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19701494 LPP is a nucleocytoplasmatic shuttle protein linking focal adhesion dynamics to the transcriptional machinery.
19693089 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19236753 Gene expression levels of bcl-6, lpp and miR-28 are different in various diffuse large B cell lymphoma cell lines.
19205907 expression of LPP and palladin are modulated by a mix of mechanical cues, oxidative stress and substrate composition which translate into their up or down regulation in vessel wall injury and early atherogenesis.
19073967 Observational study of gene-disease association. (HuGE Navigator)
17322171 The function of LPP and palladin is context dependent, that they play a critical role in cytoskeletal remodeling, respond to signals induced by vascular injury as well as signals that induce smooth muscle cell hypertrophy, such as angiotension II.
16738319 By manipulating LPP levels, we show that it acts to upregulate the transactivation capacity of PEA3.
16484626 LPP can shuttle between the cytoplasm and the nucleus, suggesting they may transfer information directly from the cytoskeleton or focal adhesions to the transcription machinery.
16397143 LPP appears to be a vascular smooth muscle (SMSC) differentiation marker that plays a role in regulating SMC migration.
16375854 HMGA2-LPP fusion promotes chondrogenesis by upregulating cartilage-specific collagen gene expression through the N-terminal DNA binding domains.
16271958 Translocation in chromosome 3 and 12 involves fusion of this protein with HMGA2 in pulmonary chondroid hamartoma.
15649318 LPP and Scrib proteins localize in cell-cell contacts. This interaction links Scrib to a communication pathway between cell-cell contacts and the nucleus, and implicates LPP in Scrib-associated functions
12505264 Expression of the HMGA2-LPP fusion transcript in only 1 of 61 karyotypically normal pulmonary chondroid hamartomas.
12441356 LPP contains specific domains that enable its focal adhesion and nuclear targeting capacity

AA Sequence

MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQPGGEGDFLPP      1 - 70
PPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPR     71 - 140
PPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTLKPQPAPQAGPIPVAPIGTLKPQPQPVPASY    141 - 210
TTASTSSRPTFNVQVKSAQPSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPG    211 - 280
LQPEPGYGYAPNQGRYYEGYYAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTG    281 - 350
PKKTYITDPVSAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCG    351 - 420
ENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCSKPIMERILRA    421 - 490
TGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDR    491 - 560
DFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSARIRVLTAKASTDL                      561 - 612
//

Text Mined References (70)

PMID Year Title
26028032 2016 LPP inhibits collective cell migration during lung cancer dissemination.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24681953 2015 Persistent STAT5 activation in myeloid neoplasms recruits p53 into gene regulation.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24465431 2014 Familial young-onset diabetes, pre-diabetes and cardiovascular disease are associated with genetic variants of DACH1 in Chinese.
24334606 2014 Fine mapping of the celiac disease-associated LPP locus reveals a potential functional variant.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23749188 2013 Genome-wide association study of B cell non-Hodgkin lymphoma identifies 3q27 as a susceptibility locus in the Chinese population.
23447672 2013 A complex containing LPP and ?-actinin mediates TGF?-induced migration and invasion of ErbB2-expressing breast cancer cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23218918 2013 White matter integrity as an intermediate phenotype: exploratory genome-wide association analysis in individuals at high risk of bipolar disorder.
23056290 2012 Association study of gene LPP in women with polycystic ovary syndrome.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22665060 2013 Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions.
22639458 2012 Contribution of LPP copy number and sequence changes to esophageal atresia, tracheoesophageal fistula, and VACTERL association.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20949626 2010 Haploinsufficiency of the LIM domain containing preferred translocation partner in lipoma (LPP) gene in patients with tetralogy of Fallot and VACTERL association.
20647273 2010 Investigation of type 1 diabetes and coeliac disease susceptibility loci for association with juvenile idiopathic arthritis.
20410501 2010 Variant of TYR and autoimmunity susceptibility loci in generalized vitiligo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851299 2010 Linkage and genome-wide association analysis of obesity-related phenotypes: association of weight with the MGAT1 gene.
19701494 2009 Cell Adhesion and Transcriptional Activity - Defining the Role of the Novel Protooncogene LPP.
19693089 2010 Four novel coeliac disease regions replicated in an association study of a Swedish-Norwegian family cohort.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19236753 2009 [Expressions of bcl-6, lpp and miR-28 genes in diffuse large B cell lymphoma cell lines].
19205907 2009 Mechanical properties of the extracellular matrix alter expression of smooth muscle protein LPP and its partner palladin; relationship to early atherosclerosis and vascular injury.
19073967 2008 Shared and distinct genetic variants in type 1 diabetes and celiac disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18311140 2008 Newly identified genetic risk variants for celiac disease related to the immune response.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17322171 2007 Angiotensin II, focal adhesion kinase, and PRX1 enhance smooth muscle expression of lipoma preferred partner and its newly identified binding partner palladin to promote cell migration.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16738319 2006 The LIM domain protein LPP is a coactivator for the ETS domain transcription factor PEA3.
16484626 2006 Organizing motility: LIM domains, LPP, and smooth muscle migration.
16397143 2006 LPP expression during in vitro smooth muscle differentiation and stent-induced vascular injury.
16375854 2006 Overexpression of HMGA2-LPP fusion transcripts promotes expression of the alpha 2 type XI collagen gene.
16271958 2005 Expression patterns of the LPP-HMGA2 fusion transcript in pulmonary chondroid hamartomas with t(3;12)(q27 approximately 28;q14 approximately 15).
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15649318 2005 The tumor suppressor Scrib interacts with the zyxin-related protein LPP, which shuttles between cell adhesion sites and the nucleus.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12760907 2003 LPP, a LIM protein highly expressed in smooth muscle.
12615977 2003 The lipoma preferred partner LPP interacts with alpha-actinin.
12581855 2003 Zyxin and paxillin proteins: focal adhesion plaque LIM domain proteins go nuclear.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12505264 2002 Expression of the HMGA2-LPP fusion transcript in only 1 of 61 karyotypically normal pulmonary chondroid hamartomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441356 2003 The focal adhesion and nuclear targeting capacity of the LIM-containing lipoma-preferred partner (LPP) protein.
12063392 2001 A novel LPP fusion gene indicates the crucial role of truncated LPP proteins in lipomas and pulmonary chondroid hamartomas.
11433529 2001 Human LPP gene is fused to MLL in a secondary acute leukemia with a t(3;11) (q28;q23).
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11066083 2000 An identical HMGIC-LPP fusion transcript is consistently expressed in pulmonary chondroid hamartomas with t(3;12)(q27-28;q14-15).
10637295 2000 LPP, an actin cytoskeleton protein related to zyxin, harbors a nuclear export signal and transcriptional activation capacity.
9772904 1998 Expression of reciprocal fusion transcripts of the HMGIC and LPP genes in parosteal lipoma.
8812423 1996 LPP, the preferred fusion partner gene of HMGIC in lipomas, is a novel member of the LIM protein gene family.
7670494 1995 Recurrent rearrangements in the high mobility group protein gene, HMGI-C, in benign mesenchymal tumours.