Property Summary

NCBI Gene PubMed Count 24
PubMed Score 29.28
PubTator Score 20.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
23792589 Structural variants unique to the malignant cell line inactivated: LPIN2, a phosphatidic acid phosphatase and a co-factor of PGC1a that is important for lipid metabolism and for suppressing autoinflammation.
23087183 We describe two brothers with Majeed syndrome, homozygous novel 2-base pair deletion in LPIN2 (c.1312_1313delCT; p.Leu438fs+16X)
22481384 LPIN1-related myolysis constitutes a major cause of early-onset rhabdomyolysis and occasionally in adults. Heterozygous LPIN1 mutations may cause mild muscular symptoms. No major defects of LPIN2 or LPIN3 genes were associated with muscle manifestations.
22334674 role of lipin-2 in the proinflammatory action of saturated fatty acids in murine and human macrophages
20735359 Data revealed that lipin 1 formed stable homo-oligomers with itself and hetero-oligomers with lipin 2/3.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20032092 Observational study of gene-disease association. (HuGE Navigator)
19717560 A conserved serine residue is required for the phosphatidate phosphatase activity but not the transcriptional coactivator functions of lipin-1 and lipin-2.
19136718 lipin 2 plays an important role as a hepatic PAP-1 enzyme.
18694939 distinct and non-redundant functions of lipin 1 and 2 regulate lipid production during the cell cycle and adipocyte differentiation
17804763 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17804763 A single nucleotide polymorphism of the LPIN2 gene is associated with type 2 diabetes and fat distribution.
15994876 We conclude that homozygous mutations in LPIN2 result in Majeed syndrome. Understanding the aberrant immune response in this condition will shed light on the aetiology of other inflammatory disorders of multifactorial aetiology
15862761 LPIN2 gene was excluded as a candidate for myopia 2 (MYP2), but the SNPs detected in this study will aid in future mapping and association studies involving this gene.

AA Sequence

MNYVGQLAGQVIVTVKELYKGINQATLSGCIDVIVVQQQDGSYQCSPFHVRFGKLGVLRSKEKVIDIEIN      1 - 70
GSAVDLHMKLGDNGEAFFVEETEEEYEKLPAYLATSPIPTEDQFFKDIDTPLVKSGGDETPSQSSDISHV     71 - 140
LETETIFTPSSVKKKKRRRKKYKQDSKKEEQAASAAAEDTCDVGVSSDDDKGAQAARGSSNASLKEEECK    141 - 210
EPLLFHSGDHYPLSDGDWSPLETTYPQTACPKSDSELEVKPAESLLRSESHMEWTWGGFPESTKVSKRER    211 - 280
SDHHPRTATITPSENTHFRVIPSEDNLISEVEKDASMEDTVCTIVKPKPRALGTQMSDPTSVAELLEPPL    281 - 350
ESTQISSMLDADHLPNAALAEAPSESKPAAKVDSPSKKKGVHKRSQHQGPDDIYLDDLKGLEPEVAALYF    351 - 420
PKSESEPGSRQWPESDTLSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSENGEISKEKFME    421 - 490
HIITYHEFAENPGLIDNPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPKATVESWVKDKMPKKSGRWWF    491 - 560
WRKRESMTKQLPESKEGKSEAPPASDLPSSSKEPAGARPAENDSSSDEGSQELEESITVDPIPTEPLSHG    561 - 630
STTSYKKSLRLSSDQIAKLKLHDGPNDVVFSITTQYQGTCRCAGTIYLWNWNDKIIISDIDGTITKSDAL    631 - 700
GQILPQLGKDWTHQGIAKLYHSINENGYKFLYCSARAIGMADMTRGYLHWVNDKGTILPRGPLMLSPSSL    701 - 770
FSAFHREVIEKKPEKFKIECLNDIKNLFAPSKQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQ    771 - 840
ERTKGNKSSYHRLSELVEHVFPLLSKEQNSAFPCPEFSSFCYWRDPIPEVDLDDLS                  841 - 896
//

Text Mined References (31)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23792589 2013 Chromosomal structural variations during progression of a prostate epithelial cell line to a malignant metastatic state inactivate the NF2, NIPSNAP1, UGT2B17, and LPIN2 genes.
23517042 2013 Genome-wide association study of body mass index in 23 000 individuals with and without asthma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23087183 2013 Efficacy of anti-IL-1 treatment in Majeed syndrome.
22481384 2012 Study of LPIN1, LPIN2 and LPIN3 in rhabdomyolysis and exercise-induced myalgia.
22334674 2012 Lipin-2 reduces proinflammatory signaling induced by saturated fatty acids in macrophages.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20735359 2010 Lipin proteins form homo- and hetero-oligomers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20032092 2010 Genetic susceptibility factors in a cohort of 38 patients with SAPHO syndrome: a study of PSTPIP2, NOD2, and LPIN2 genes.
19717560 2009 A conserved serine residue is required for the phosphatidate phosphatase activity but not the transcriptional coactivator functions of lipin-1 and lipin-2.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19136718 2009 Lipin 2 is a liver-enriched phosphatidate phosphohydrolase enzyme that is dynamically regulated by fasting and obesity in mice.
18694939 2008 Temporal and spatial regulation of the phosphatidate phosphatases lipin 1 and 2.
18088087 2008 Phosphoproteome of resting human platelets.
17804763 2007 LPIN2 is associated with type 2 diabetes, glucose metabolism, and body composition.
17158099 2007 Three mammalian lipins act as phosphatidate phosphatases with distinct tissue expression patterns.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15994876 2005 Homozygous mutations in LPIN2 are responsible for the syndrome of chronic recurrent multifocal osteomyelitis and congenital dyserythropoietic anaemia (Majeed syndrome).
15862761 2005 Evaluation of Lipin 2 as a candidate gene for autosomal dominant 1 high-grade myopia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11138012 2001 Lipodystrophy in the fld mouse results from mutation of a new gene encoding a nuclear protein, lipin.
10884287 2000 Adipose tissue deficiency, glucose intolerance, and increased atherosclerosis result from mutation in the mouse fatty liver dystrophy (fld) gene.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
8944226 1996 Biosynthesis of triacylglycerols.
2722772 1989 The fatty liver dystrophy (fld) mutation. A new mutant mouse with a developmental abnormality in triglyceride metabolism and associated tissue-specific defects in lipoprotein lipase and hepatic lipase activities.