Property Summary

NCBI Gene PubMed Count 63
PubMed Score 135.01
PubTator Score 106.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
chronic lymphocytic leukemia -1.519 8.8e-07
astrocytic glioma 1.500 5.7e-03
oligodendroglioma 1.200 6.0e-03
esophageal adenocarcinoma -1.200 1.8e-02
psoriasis -1.500 4.8e-07
osteosarcoma 2.380 5.5e-08
medulloblastoma, large-cell 1.300 1.7e-03
Duchenne muscular dystrophy -1.068 1.7e-04
limb girdle muscular dystrophy 2B -1.268 7.9e-05
autosomal dominant Emery-Dreifuss muscul... -1.262 7.1e-03
Becker muscular dystrophy -1.089 1.0e-02
hereditary spastic paraplegia -1.119 1.3e-02
Amyotrophic Lateral Sclerosis -1.118 7.6e-05
primary pancreatic ductal adenocarcinoma 1.329 3.1e-02
intraductal papillary-mucinous carcinoma... 1.600 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.600 6.6e-03
lung cancer -1.400 1.4e-02
active Crohn's disease 2.380 1.6e-03
ulcerative colitis 2.400 1.5e-10
breast carcinoma -1.100 8.0e-04
adult high grade glioma -1.200 1.1e-03
Pick disease -1.100 3.7e-05
ovarian cancer -1.500 6.3e-05
Gaucher disease type 1 -1.500 3.3e-02
dermatomyositis -1.800 8.5e-04

Gene RIF (58)

PMID Text
26288136 lipin-1 has a critical role in the regulation of macrophage inflammatory responses to modified-LDL
26276647 Results of our study suggest that rs2716610: C>T polymorphism of LPIN1 gene could have a protective effect against development of metabolic syndrome, while rs11693809: C>T might affect a glucose control in patients with MS.
25974997 Lipin1beta might play a role in the pathogenesis of insulin resistance in gestational diabetes mellitus
25834103 Lipin-1 controls main cellular processes involved in cancer progression and that its targeting, alone or in combination with other treatments, could open new avenues in anticancer therapy.
25475986 LPIN1 plays a functional role in lipid synthesis and storage, a role which is highly conserved from human to yeast.
24558042 the lipin-1 N-terminal domain is important for its catalytic activity, nuclear localization, and binding to PP-1cgamma
23928362 Lipin-1 deficiency is associated with lipid metabolism alterations resulting in massive rhabdomyolysis.
23426382 the SNP in the LPIN1 gene (rs10192566) had no effect on the trough rosiglitazone steady-state concentration.
23426360 Phosphorylation of lipin 1 and charge on the phosphatidic acid head group control its phosphatidic acid phosphatase activity and membrane association
22853689 Data suggests common single nucleotide polymorphisms within the LPIN1 region were associated with Type 2 diabetes and metabolic traits in the Chinese population.
22481384 LPIN1-related myolysis constitutes a major cause of early-onset rhabdomyolysis and occasionally in adults. Heterozygous LPIN1 mutations may cause mild muscular symptoms. No major defects of LPIN2 or LPIN3 genes were associated with muscle manifestations.
22480698 LPIN1 mutations should be considered in any child presenting with severe rhabdomyolysis.
22467849 We conclude that direct control of lipin 1 transcription by HIF-1 is an important regulatory feature of lipid metabolism and its adaptation to hypoxia.
22157924 Lipin1 rs13412852 single nucleotide polymorphism is associated with the severity of liver damage and fibrosis progression in pediatric patients with histological NAFLD.
22055193 Lpin1 expression in response to nutritional stress is controlled through the reactive oxygen species-ATM-p53 pathway.
21911493 Estrogen-related receptor gamma (ERRgamma) is a novel transcriptional regulator of phosphatidic acid phosphatase, LIPIN1, and inhibits hepatic insulin signaling
21803291 reduced expression of SFRS10, as observed in tissues from obese humans, alters LPIN1 splicing, induces lipogenesis, and therefore contributes to metabolic phenotypes associated with obesity.
21616074 lipin-1gamma is the main lipin-1 isoform expressed in normal human brain, suggesting a specialized role in regulating brain lipid metabolism.
21478406 data suggest that lipin-1 associates with lipid droplets and regulates the activation of cytosolic group IVA phospholipase A(2)alpha in monocyte-derived macrophages
21448847 The aim of present study was to investigate for the first time the association of lipin 1 gene polymorphisms with metabolic and hormonal profile in polycystic ovary syndrome patients and controls.
21413788 dullard shows specificity for the peptide corresponding to the insulin-dependent phosphorylation site (Ser106) of lipin
21263402 PPARG and LPIN1 gene polymorphisms role of these genes in lipid metabolism and pathogenesis of type 2 diabetes and metabolic syndrome
20735359 Data revealed that lipin 1 formed stable homo-oligomers with itself and hetero-oligomers with lipin 2/3.
20583302 Data suggest that the high frequency of the intragenic LPIN1 deletion should provide a valuable criterion for fast diagnosis, prior to muscle biopsy.
20530740 the low-grade proinflammatory environment and the insulin resistance associated with obesity may contribute to downregulate LPIN1 in adipose tissue
20356931 LPIN1 rs33997857, rs6744682, and rs6708316 did not associate with type 2 diabetes, obesity, or related quantitative metabolic phenotypes in the Danish population examined.
20356931 Observational study of gene-disease association. (HuGE Navigator)
20308432 Observational study of gene-disease association. (HuGE Navigator)
20101248 Results showed a marked association between LPIN1 and PPARalpha gene expression both in subcutaneous and visceral adipose tissues and might suggest a possible role of LPIN1 in stress conditions that occur in chronic obesity and underlie insulin resistance
19753306 sumoylation facilitates the nuclear localization and transcriptional coactivator behavior of lipin-1alpha, which may act as a sumoylation-regulated transcriptional coactivator in brain
19717560 A conserved serine residue is required for the phosphatidate phosphatase activity but not the transcriptional coactivator functions of lipin-1 and lipin-2.
19553673 sterol-mediated regulation of lipin 1 gene transcription modulates triglyceride accumulation
19543209 the LPIN1 gene seemed not to be a major susceptibility gene for type 2 diabetes or related metabolic phenotypes in the Chinese population.
19543209 Observational study of gene-disease association. (HuGE Navigator)
18974842 Observational study of gene-disease association. (HuGE Navigator)
18829900 Decreased expression of lipin 1 beta in visceral and subcutaneous adipose tissue appears to contribute to the pathogenesis of insulin resistance in polycystic ovary syndrome.
18817903 Mutations in the LPIN1 gene cause recurrent rhabdomyolysis in childhood, and a carrier state may predispose for statin-induced myopathy
18694939 distinct and non-redundant functions of lipin 1 and 2 regulate lipid production during the cell cycle and adipocyte differentiation
18693052 LPIN1 genetic variations can affect rosiglitazone treatment response in T2DM.
18693052 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18591397 Our data do not support a major effect of common LPIN1 variation on metabolic traits and suggest that mutations in LPIN1 are not a common cause of lipodystrophy in humans
18591397 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18437145 Study provides further evidence that lipin 1 may play a role in blood pressure regulation, especially in men.
18437145 Observational study of gene-disease association. (HuGE Navigator)
18362392 Lpin1 glucocorticoid response element binds to the glucocorticoid receptor
18070763 Sequence variation in the LPIN1 gene contributes to variation in resting metabolic rate and obesity-related phenotypes potentially in an age-dependent manner.
18070763 Observational study of gene-disease association. (HuGE Navigator)
17950103 LPIN1 messenger RNA levels positively correlated with insulin sensitivity in all subjects with obesity, NIDDM, and HIV-associated lipodystrophy
17940119 Observational study of gene-disease association. (HuGE Navigator)
17940119 Variants of the LPIN1 gene have significant effects in human metabolic traits and implicate lipin in the pathophysiology of the metabolic syndrome.
17563064 Lipin 1beta and overexpression of peroxisome proliferator-activated receptor-gamma coactivator (PGC)-1alpha are downregulated by obesity and obesity-related metabolic perturbations in human subjects.
17105729 insulin and epinephrine control lipin primarily by changing localization rather than intrinsic PAP activity
17035674 Body fat accumulation is a major regulator of human adipose LPIN1 expression and suggests a role of LPIN1 in human preadipocyte as well as mature adipocyte function.
17003347 These results suggest that increased adipogenesis and/or lipogenesis in subcutaneous fat, mediated by the LPIN1 gene, may prevent lipotoxicity in muscle, leading to improved insulin sensitivity
16950137 Lipin 1 is an inducible amplifier of the hepatic PGC-1alpha/PPARalpha regulatory pathway
16467296 human lipin 1 is a Mg2+-dependent PA phosphatase, the penultimate enzyme in the pathway to synthesize triacylglyerol
16357106 effects of genetic variation in lipin levels on glucose homeostasis across species by analyzing lipin transcript levels in human and mouse adipose tissues
12111372 LPIN1 mutations are not commonly seen in patients with lipodystrophy who had no mutations in known disease genes.

AA Sequence

MNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRSREKVVDIEIN      1 - 70
GESVDLHMKLGDNGEAFFVQETDNDQEVIPMHLATSPILSEGASRMECQLKRGSVDRMRGLDPSTPAQVI     71 - 140
APSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDEDMFPIEMSSDEAMELLESSRTLPNDIPPFQD    141 - 210
DIPEENLSLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQKNPEMLWLWGELPQ    211 - 280
AAKSSSPHKMKESSPLSSRKICDKSHFQAIHSESSDTFSDQSPTLVGGALLDQNKPQTEMQFVNEEDLET    281 - 350
LGAAAPLLPMIEELKPPSASVVQTANKTDSPSRKRDKRSRHLGADGVYLDDLTDMDPEVAALYFPKNGDP    351 - 420
SGLAKHASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIAISLCGGLSDHREITKDAFLEQAVSY    421 - 490
QQFVDNPAIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVESIMRDKMPKKGGRWWFSWRGR    491 - 560
NTTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSSSDEERAAAKPSNAGHLPLLPNVSYKKTLRL    561 - 630
TSEQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDW    631 - 700
THQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLHWVNERGTVLPQGPLLLSPSSLFSALHREVIEK    701 - 770
KPEKFKVQCLTDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYV    771 - 840
RLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA                        841 - 890
//

Text Mined References (69)

PMID Year Title
26288136 2015 Lipin-1 contributes to modified low-density lipoprotein-elicited macrophage pro-inflammatory responses.
26276647 2015 Association of LPIN1 gene variations with markers of metabolic syndrome in population from Bosnia and Herzegovina.
25974997 2015 Changes of lipin1? expression in gestational diabetes mellitus.
25834103 2015 Lipin-1 regulates cancer cell phenotype and is a potential target to potentiate rapamycin treatment.
25475986 2014 Phosphatidate phosphatase-1 is functionally conserved in lipid synthesis and storage from human to yeast.
24558042 2014 Conserved residues in the N terminus of lipin-1 are required for binding to protein phosphatase-1c, nuclear translocation, and phosphatidate phosphatase activity.
23928362 2013 Combination of lipid metabolism alterations and their sensitivity to inflammatory cytokines in human lipin-1-deficient myoblasts.
23426382 2013 The role of genetic variants in CYP2C8, LPIN1, PPARGC1A and PPAR? on the trough steady-state plasma concentrations of rosiglitazone and on glycosylated haemoglobin A1c in type 2 diabetes.
23426360 2013 Phosphorylation of lipin 1 and charge on the phosphatidic acid head group control its phosphatidic acid phosphatase activity and membrane association.
22853689 2013 Genetic variants of LPIN1 indicate an association with Type 2 diabetes mellitus in a Chinese population.
22481384 2012 Study of LPIN1, LPIN2 and LPIN3 in rhabdomyolysis and exercise-induced myalgia.
22480698 2012 Fatal rhabdomyolysis in 2 children with LPIN1 mutations.
22467849 2012 Hypoxia causes triglyceride accumulation by HIF-1-mediated stimulation of lipin 1 expression.
22157924 2012 LPIN1 rs13412852 polymorphism in pediatric nonalcoholic fatty liver disease.
22134922 2012 Nuclear envelope phosphatase 1-regulatory subunit 1 (formerly TMEM188) is the metazoan Spo7p ortholog and functions in the lipin activation pathway.
22055193 2011 ROS-mediated p53 induction of Lpin1 regulates fatty acid oxidation in response to nutritional stress.
21911493 2011 Estrogen-related receptor ? (ERR?) is a novel transcriptional regulator of phosphatidic acid phosphatase, LIPIN1, and inhibits hepatic insulin signaling.
21803291 2011 Expression of the splicing factor gene SFRS10 is reduced in human obesity and contributes to enhanced lipogenesis.
21616074 2011 Lipin-1? isoform is a novel lipid droplet-associated protein highly expressed in the brain.
21478406 2011 Subcellular localization and role of lipin-1 in human macrophages.
21448847 2011 Lipin 1 gene polymorphisms in polycystic ovary syndrome.
21413788 2011 Homo sapiens dullard protein phosphatase shows a preference for the insulin-dependent phosphorylation site of lipin1.
21263402 2011 Association of PPARG and LPIN1 gene polymorphisms with metabolic syndrome and type 2 diabetes.
20735359 2010 Lipin proteins form homo- and hetero-oligomers.
20583302 2010 LPIN1 gene mutations: a major cause of severe rhabdomyolysis in early childhood.
20530740 2010 Lpin1 in human visceral and subcutaneous adipose tissue: similar levels but different associations with lipogenic and lipolytic genes.
20356931 2010 Studies of association between LPIN1 variants and common metabolic phenotypes among 17,538 Danes.
20308432 2010 Association analysis of 33 lipoprotein candidate genes in multi-generational families of African ancestry.
20231281 2010 Characterization of the human LPIN1-encoded phosphatidate phosphatase isoforms.
20101248 2010 Relation between human LPIN1, hypoxia and endoplasmic reticulum stress genes in subcutaneous and visceral adipose tissue.
19753306 2009 Sumoylation regulates nuclear localization of lipin-1alpha in neuronal cells.
19717560 2009 A conserved serine residue is required for the phosphatidate phosphatase activity but not the transcriptional coactivator functions of lipin-1 and lipin-2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19553673 2009 Sterol-mediated regulation of human lipin 1 gene expression in hepatoblastoma cells.
19543209 2010 The associations of LPIN1 gene expression in adipose tissue with metabolic phenotypes in the Chinese population.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18829900 2008 Decreased lipin 1 beta expression in visceral adipose tissue is associated with insulin resistance in polycystic ovary syndrome.
18817903 2008 Mutations in LPIN1 cause recurrent acute myoglobinuria in childhood.
18694939 2008 Temporal and spatial regulation of the phosphatidate phosphatases lipin 1 and 2.
18693052 LPIN1 genetic variation is associated with rosiglitazone response in type 2 diabetic patients.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18591397 2008 Evaluating the role of LPIN1 variation in insulin resistance, body weight, and human lipodystrophy in U.K. Populations.
18437145 2008 Association of a polymorphism in the lipin 1 gene with systolic blood pressure in men.
18362392 2008 Regulation of lipin-1 gene expression by glucocorticoids during adipogenesis.
18070763 2007 Association of lipin 1 gene polymorphisms with measures of energy and glucose metabolism.
17950103 2007 Human subcutaneous adipose tissue LPIN1 expression in obesity, type 2 diabetes mellitus, and human immunodeficiency virus--associated lipodystrophy syndrome.
17940119 2008 Genetic variants within the LPIN1 gene, encoding lipin, are influencing phenotypes of the metabolic syndrome in humans.
17563064 2007 Hepatic lipin 1beta expression is diminished in insulin-resistant obese subjects and is reactivated by marked weight loss.
17158099 2007 Three mammalian lipins act as phosphatidate phosphatases with distinct tissue expression patterns.
17105729 2007 Insulin controls subcellular localization and multisite phosphorylation of the phosphatidic acid phosphatase, lipin 1.
17035674 2007 A role of lipin in human obesity and insulin resistance: relation to adipocyte glucose transport and GLUT4 expression.
17003347 2006 Lipin expression is attenuated in adipose tissue of insulin-resistant human subjects and increases with peroxisome proliferator-activated receptor gamma activation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16950137 2006 Lipin 1 is an inducible amplifier of the hepatic PGC-1alpha/PPARalpha regulatory pathway.
16467296 2006 The Saccharomyces cerevisiae Lipin homolog is a Mg2+-dependent phosphatidate phosphatase enzyme.
16357106 2006 Cross-species analyses implicate Lipin 1 involvement in human glucose metabolism.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12111372 2002 Identification of single-nucleotide polymorphisms in the human LPIN1 gene.
11792863 2002 Insulin-stimulated phosphorylation of lipin mediated by the mammalian target of rapamycin.
11138012 2001 Lipodystrophy in the fld mouse results from mutation of a new gene encoding a nuclear protein, lipin.
10884287 2000 Adipose tissue deficiency, glucose intolerance, and increased atherosclerosis result from mutation in the mouse fatty liver dystrophy (fld) gene.
10644441 1999 Genetic, physical, and transcript map of the fld region on mouse chromosome 12.
8944226 1996 Biosynthesis of triacylglycerols.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.