| Tbio | Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 |
Lysophosphatidylglycerol (LPG) specific acyltransferase that recognizes various acyl-CoAs and LPGs as substrates but demonstrates a clear preference for long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors. Prefers oleoyl-LPG over palmitoyl-LPG as an acyl receptor and oleoyl-CoA over lauroyl-CoA as an acyl donor.
This gene encodes a member of the lysophospholipid acyltransferase family. The encoded protein catalyzes the reacylation of lysophosphatidylglycerol to phosphatidylglycerol, a membrane phospholipid that is an important precursor for the synthesis of cardiolipin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
This gene encodes a member of the lysophospholipid acyltransferase family. The encoded protein catalyzes the reacylation of lysophosphatidylglycerol to phosphatidylglycerol, a membrane phospholipid that is an important precursor for the synthesis of cardiolipin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Weight Gain | 100 | 0.0 | 0.0 |
| Disease | Target Count | P-value |
|---|---|---|
| atypical teratoid / rhabdoid tumor | 5112 | 1.0e-08 |
| glioblastoma | 5792 | 1.7e-07 |
| ulcerative colitis | 1819 | 1.0e-05 |
| osteosarcoma | 7950 | 1.2e-05 |
| ovarian cancer | 8520 | 1.8e-05 |
| group 4 medulloblastoma | 1855 | 3.7e-05 |
| Astrocytoma, Pilocytic | 3081 | 4.0e-05 |
| astrocytic glioma | 2597 | 1.2e-03 |
| medulloblastoma, large-cell | 6241 | 2.1e-03 |
| adult high grade glioma | 3801 | 2.9e-03 |
| primitive neuroectodermal tumor | 3035 | 3.5e-03 |
| inflammatory breast cancer | 286 | 3.7e-03 |
| ependymoma | 4679 | 4.6e-03 |
| subependymal giant cell astrocytoma | 2287 | 6.2e-03 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 1.5e-02 |
| pancreatic ductal adenocarcinoma liver metastasis | 1962 | 1.7e-02 |
| active Crohn's disease | 922 | 1.7e-02 |
| gastric carcinoma | 807 | 1.8e-02 |
| Pick disease | 1894 | 2.1e-02 |
| oligodendroglioma | 2850 | 2.7e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Short bowel syndrome | 16 | 3.557 | 1.8 |
| Disease | log2 FC | p |
|---|---|---|
| active Crohn's disease | 1.622 | 1.7e-02 |
| adult high grade glioma | -1.100 | 2.9e-03 |
| astrocytic glioma | -1.200 | 1.2e-03 |
| Astrocytoma, Pilocytic | -1.300 | 4.0e-05 |
| atypical teratoid / rhabdoid tumor | -2.100 | 1.0e-08 |
| ependymoma | -1.200 | 4.6e-03 |
| gastric carcinoma | 1.300 | 1.8e-02 |
| glioblastoma | -1.400 | 1.7e-07 |
| group 4 medulloblastoma | -1.600 | 3.7e-05 |
| inflammatory breast cancer | 1.100 | 3.7e-03 |
| intraductal papillary-mucinous carcinoma... | 1.400 | 1.5e-02 |
| medulloblastoma, large-cell | -1.100 | 2.1e-03 |
| oligodendroglioma | -1.800 | 2.7e-02 |
| osteosarcoma | -1.516 | 1.2e-05 |
| ovarian cancer | -1.200 | 1.8e-05 |
| pancreatic ductal adenocarcinoma liver m... | -1.168 | 1.7e-02 |
| Pick disease | 1.100 | 2.1e-02 |
| primitive neuroectodermal tumor | -1.200 | 3.5e-03 |
| subependymal giant cell astrocytoma | -1.196 | 6.2e-03 |
| ulcerative colitis | 2.200 | 1.0e-05 |
| Species | Source | Disease |
|---|---|---|
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG |
MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVA 1 - 70 SWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIV 71 - 140 SLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNV 141 - 210 TLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVT 211 - 280 HVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSF 281 - 350 AFLSGYMWYNIIQYFYHCLF 351 - 370 //
