Property Summary

NCBI Gene PubMed Count 23
PubMed Score 153.56
PubTator Score 76.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.156 9.9e-04
pancreatic ductal adenocarcinoma liver m... -1.208 9.5e-03
ulcerative colitis -1.300 1.1e-07

Protein-protein Interaction (9)

Gene RIF (9)

PMID Text
25994902 Our findings suggest that LPCAT3 plays an important role in M1/M2-macrophage polarization, providing novel potential therapeutic targets for the regulation of immune and inflammatory disorders
23580142 LPCAT3 a key contributor to the human macrophages inflammatory response.
20837115 Results establish for the first time that LPCAT3 is specifically regulated by LXRalpha.
20018618 lysoPC acyltransferase 3 is a novel-signal-regulated enzyme that is centrally implicated in limiting free arachidonic acid levels in activated cells
19351971 characterization of LPCAT3; LPCAT3 expression in tissue culture increased phospholipids with relatively more saturated acyl chains; limiting LPCAT3 expression increased abundance of phospholipids with more unsaturated acyl chains
18782225 These results indicate that human MBOAT5 is a lysophospholipid acyltransferase acting preferentially on lysophosphatidylcholine, lysophosphatidylserine and lysophosphatidylethanolamine.
18781350 LPCAT3 is involved in phospholipids remodeling to achieve appropriate membrane lipid fatty acid composition.
18772128 MBOAT5 and MBOAT7 in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils
18195019 LPCAT3 is primarily responsible for hepatic LPCAT activity

AA Sequence

MASSAEGDEGTVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRHYLFYKETYLI      1 - 70
HLFHTFTGLSIAYFNFGNQLYHSLLCIVLQFLILRLMGRTITAVLTTFCFQMAYLLAGYYYTATGNYDIK     71 - 140
WTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMK    141 - 210
LVQGELIDIPGKIPNSIIPALKRLSLGLFYLVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFV    211 - 280
LYKYVTCWLVTEGVCILTGLGFNGFEEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIF    281 - 350
KRLKFLGNKELSQGLSLLFLALWHGLHSGYLVCFQMEFLIVIVERQAARLIQESPTLSKLAAITVLQPFY    351 - 420
YLVQQTIHWLFMGYSMTAFCLFTWDKWLKVYKSIYFLGHIFFLSLLFILPYIHKAMVPRKEKLKKME       421 - 487
//

Text Mined References (25)

PMID Year Title
25994902 2015 Essential Role of Lysophosphatidylcholine Acyltransferase 3 in the Induction of Macrophage Polarization in PMA-Treated U937 Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23580142 2013 Liver x receptor regulates arachidonic acid distribution and eicosanoid release in human macrophages: a key role for lysophosphatidylcholine acyltransferase 3.
22511767 2012 Lysophosphatidylcholine acyltransferase 3 knockdown-mediated liver lysophosphatidylcholine accumulation promotes very low density lipoprotein production by enhancing microsomal triglyceride transfer protein expression.
20837115 2011 Regulation of LPCAT3 by LXR.
20018618 2010 Signaling role for lysophosphatidylcholine acyltransferase 3 in receptor-regulated arachidonic acid reacylation reactions in human monocytes.
19946888 2010 Defining the membrane proteome of NK cells.
19351971 2009 Characterization of human lysophospholipid acyltransferase 3.
18782225 2008 Member of the membrane-bound O-acyltransferase (MBOAT) family encodes a lysophospholipid acyltransferase with broad substrate specificity.
18781350 2008 Substrate preferences of a lysophosphatidylcholine acyltransferase highlight its role in phospholipid remodeling.
18772128 2008 Lysophospholipid acyltransferases and arachidonate recycling in human neutrophils.
18195019 2008 Identification and characterization of a major liver lysophosphatidylcholine acyltransferase.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10446276 1999 nessy, an evolutionary conserved gene controlled by Hox proteins during Drosophila embryogenesis.
9074930 1997 Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination.
8723724 1996 A gene-rich cluster between the CD4 and triosephosphate isomerase genes at human chromosome 12p13.