Property Summary

NCBI Gene PubMed Count 37
PubMed Score 35.05
PubTator Score 51.98

Knowledge Summary

Patent (5,909)

TINX Plot

  Disease (7)

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.315 2.4e-03
adult high grade glioma 1.700 3.9e-03
Astrocytoma, Pilocytic 2.200 2.2e-07
Breast cancer 2.500 4.1e-02
breast carcinoma -1.100 1.6e-04
ependymoma 1.400 4.6e-06
Gaucher disease type 3 -1.600 4.5e-02
glioblastoma 1.700 7.4e-06
juvenile dermatomyositis 1.041 3.9e-10
lung cancer 1.300 1.6e-04
malignant mesothelioma -3.400 2.2e-07
ovarian cancer -2.100 8.2e-05
primitive neuroectodermal tumor 1.100 3.7e-03
sarcoidosis 1.200 4.1e-03
sonic hedgehog group medulloblastoma 1.500 3.9e-03
subependymal giant cell astrocytoma 3.273 6.7e-03

Gene RIF (21)

AA Sequence

MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTL      1 - 70
PFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGV     71 - 140
WLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKT    141 - 210
LTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIA    211 - 280
VSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA          281 - 344
//

Text Mined References (38)

PMID Year Title