Property Summary

NCBI Gene PubMed Count 18
PubMed Score 20.69
PubTator Score 19.02

Knowledge Summary

Patent (4,871)

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 2514 1.7e-08
malignant mesothelioma 3163 1.2e-06
psoriasis 6685 4.8e-04
pilocytic astrocytoma 3086 7.4e-04
group 3 medulloblastoma 2254 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.500 1.2e-06
psoriasis -1.900 4.8e-04
ependymoma 2.700 1.7e-08
group 3 medulloblastoma 2.500 6.7e-03
pilocytic astrocytoma 1.200 7.4e-04

Gene RIF (6)

PMID Text
25849892 These results suggest that the diverse roles of LPA4, LPA5 and LPA6 are involved in the activation of tumor progression in pancreatic cancer cells.
23467751 Our data suggest that LPA4 signaling potentially modulates malignant behavior of SQ-20B cells.
20890765 LPA4 gene mutation may play some role in the pathogenesis of colon cancer.
20069565 LPA4 and LPA5 receptors induce osteoblastic differentiation of human mesenchymal stem cells
19860625 Data show that CLL cells express LPA receptors LPA(1-5) and VEGF receptors, and the plasma levels of VEGF are elevated in CLL patients.
12724320 identified as the fourth lysophosphatidic acid (LPA) receptor; shares only 20-24% amino acid identities with Edg-2/LPA1, Edg-4/LPA2, and Edg-7/LPA3, and phylogenetic analysis also shows that p2y9/GPR23 is far distant from the Edg family

AA Sequence

MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKM      1 - 70
RSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAI     71 - 140
VYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEV    141 - 210
VGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAI    211 - 280
TNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQ    281 - 350
EEVSDQTTNNGGELMLESTF                                                      351 - 370
//

Text Mined References (19)

PMID Year Title
25849892 2015 Diverse effects of LPA4, LPA5 and LPA6 on the activation of tumor progression in pancreatic cancer cells.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
23467751 2013 Lysophosphatidic acid receptor 4 signaling potentially modulates malignant behavior in human head and neck squamous cell carcinoma cells.
20890765 2010 Differential expressions and DNA methylation patterns of lysophosphatidic acid receptor genes in human colon cancer cells.
20069565 2010 LPA induces osteoblast differentiation through interplay of two receptors: LPA1 and LPA4.
19860625 2009 Lysophosphatidic acid receptor expression in chronic lymphocytic leukemia leads to cell survival mediated though vascular endothelial growth factor expression.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12724320 2003 Identification of p2y9/GPR23 as a novel G protein-coupled receptor for lysophosphatidic acid, structurally distant from the Edg family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11004484 2000 Expression of purinergic receptors (ionotropic P2X1-7 and metabotropic P2Y1-11) during myeloid differentiation of HL60 cells.
9223435 1997 Cloning of a human heptahelical receptor closely related to the P2Y5 receptor.
9073069 1997 Cloning and chromosomal mapping of four putative novel human G-protein-coupled receptor genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.