Property Summary

Ligand Count 33
NCBI Gene PubMed Count 58
PubMed Score 89.31
PubTator Score 86.06

Knowledge Summary

Patent (14,243)

TINX Plot

Expression

  Differential Expression (6)

Protein-protein Interaction (2)

Gene RIF (35)

AA Sequence

MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYL      1 - 70
LGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHS     71 - 140
RLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSRMAPLLSRSYLAVWALSSLLVFLLMVAVYTR    141 - 210
IFFYVRRRVQRMAEHVSCHPRYRETTLSLVKTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYF    211 - 280
LLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDST    281 - 350
L//

Text Mined References (58)

PMID Year Title