Property Summary

NCBI Gene PubMed Count 80
PubMed Score 222.69
PubTator Score 153.33

Knowledge Summary

Patent (23,418)

TINX Plot

  Disease (6)

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.853 1.5e-02
adult high grade glioma -1.100 3.9e-02
astrocytic glioma -2.600 2.3e-02
Atopic dermatitis -1.400 5.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.012 1.3e-02
colon cancer -1.300 3.2e-02
Down syndrome 1.400 3.3e-03
Duchenne muscular dystrophy 1.099 2.4e-07
ependymoma -2.400 4.7e-02
glioblastoma -1.100 3.7e-02
group 3 medulloblastoma -2.400 1.8e-03
invasive ductal carcinoma -1.900 4.3e-03
lung cancer -2.000 5.9e-03
lung carcinoma -1.800 3.1e-19
malignant mesothelioma -5.200 1.6e-08
medulloblastoma, large-cell -3.100 1.0e-05
oligodendroglioma -1.900 2.2e-07
osteosarcoma 3.837 8.3e-08
ovarian cancer -2.000 4.9e-07
pituitary cancer -1.200 1.3e-03
primary Sjogren syndrome 1.100 4.9e-03
primitive neuroectodermal tumor -1.900 7.4e-03
psoriasis -1.300 5.9e-05
subependymal giant cell astrocytoma -2.044 2.5e-02

Gene RIF (62)

AA Sequence

MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLV      1 - 70
MVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLL     71 - 140
AIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFW    141 - 210
AIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLL    211 - 280
DVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNH    281 - 350
TILAGVHSNDHSVV                                                            351 - 364
//

Text Mined References (86)

PMID Year Title