Property Summary

NCBI Gene PubMed Count 286
PubMed Score 3549.49
PubTator Score 2482.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.002 2.9e-03
psoriasis -1.100 4.9e-03

 OMIM Phenotype (1)

Gene RIF (262)

PMID Text
27005778 Genetic fine mapping and Mendelian randomization uncover wide-spread causal effects of lipoprotein(a) on overall lipoprotein metabolism leading to increased cardiovascular risk.
26975530 apo(a) has a plasma residence time that is more than twice as long as that of apoB-100within Lp(a)
26900838 Apolipoprotein(a) Kringle-IV Type 2 Copy Number Variation Is Associated with Venous Thromboembolism
26776177 tests of association using logistic regression assuming an additive genetic model revealed no significant associations (p<0.05) for any of the five LPA variants previously associated with Lp(a) levels in African Americans
26710333 High plasma lipoprotein a value is associated with poor prognosis after percutaneous coronary intervention for patients with chronic kidney disease.
26632531 These data demonstrate that serum Lp(a) is elevated in patients with FH caused by PCSK9 gain-of-function mutations to the same level as that in FH caused by LDLR mutations.
26546997 Increased serum Lp(a) levels were independent predictors of deep vein thrombosis in patients with spinal cord injuries in China
26518096 Report a significant and independent association between elevated Lp(a) and peripheral arterial disease among Hispanic women and men.
26515419 In statin-treated men with type 2 diabetes mellitus, niacin decreased plasma Lp(a) concentrations by decreasing the production of apo(a) and Lp(a)-apoB-100.
26412029 Data suggest plasma levels of PCSK9 (proprotein convertase subtilisin/kexin type 9) and lipoprotein(a) are significantly up-regulated in patients with type 2 diabetes as compared to control subject; study was conducted in Tunisia.
26407666 oxLp(a) induced autophagy via LKB1-AMPK-mTOR and PAPR-1-LKB1-AMPK-mTOR pathways, which are dependent on ROS generation
26377243 study provides evidence that ancestry-specific causal risk variant(s) resides in or near LPA and that most of the observed associations outside this narrower region are spurious associations.
26361154 Elevated levels of lipoprotein a mediates aortic valve stenosis progression through its association with oxidized phospholipids.
26302166 LPA rs3798220 does not appear to be associated with small apolipoprotein(a) isoforms and high lipoprotein(a) levels in East and Southeast Asians
26298741 Elevated Lp(a) is an independent risk factor for ischemic stroke and may be especially relevant for young stroke patients [meta-analysis]
26224810 In the lipoprotein(a) fraction in circulation, a high level of autotaxin activity was detected.
26222903 The Lp(a) levels were not associated with atherosclerosis in the carotid arteries of statin-treated familial hypercholesterolemia patients.
26147378 generated a human apo(a)-transgenic miniature pig that can be used as a model system to study advanced atherosclerosis related to human disease.
25938632 Elevated levels of lipoprotein(a) were not causally associated with increased low-grade inflammation despite a causal association with increased risk of aortic valve stenosis and myocardial infarction.
25936334 A Lp(a) plasma level of higher than about 300 mg/L seems to be a threshold for occurring of cardiovascular events. The combination of raised Lp(a) with arterial hypertension was found to be the most important cardiovascular risk factor.
25936330 Pre-apheresis Lp(a) levels are lower than those before the start of a lipoprotein apheresis treatment but they behave differently among patients during LA treatment.
25936321 Isolated extracorporeal Lp(a) elimination over an 18 months period produced regression of carotid intima-media thickness in stable CHD patients with high Lp(a) levels.
25936320 Lipid apheresis treatment of patients with high risk for CVD due to Lp(a) hyperlipoproteinemia was effective, safe, and well tolerated.
25936312 Assess the role of lipoprotein apheresis in patients with refractory angina and raised Lp(a).
25936305 Niacin lowers elevated Lp(a) level in male subjects with low- but not high-molecular weight apo(a) phenotype.
25871336 Lipoprotein(a) might contribute to the development of atherosclerotic renal artery stenosis and detection of elevated levels of this lipoprotein could raise the suspicion of renovascular disease
25865336 High lipoprotein a levels in angina pectoris patients was significantly associated with binary restenosis in an Asian population.
25861813 Lipoprotein(a) is an independent predictor for the severity of new on-set coronary artery disease patients accompanied by type 2 diabetes.
25852127 Lp(a) was internalized by HepG2 cells, however, the ABCA1 response to Lp(a) was mediated by the selective uptake of oxidized phospholipids
25810300 Race is an important factor when considering the Lp(a) level that imposes a significant risk of coronary heart disease development.
25778403 LDLR plays a role in Lp(a) catabolism and that this process can be modulated by PCSK9
25676008 We detected low adiponectin and high Lp(a) levels in patients with CSX and these findings may be related to the microvascular injury in CSX.
25649924 lipoprotein (a) concentrations are inversely associated with T2D, prediabetes, and insulin resistance in a middle-aged and elderly Chinese population
25633186 Results suggest a possible route of Lp(a) attachment to vascular cells that offer terminal galactose on surface glycans following desialylation.
25614280 Meta-analysis: ApoB100 antisense oligonucleotide mipomersen consistently and effectively reduced Lp(a) levels in patients with a variety of lipid abnormalities and cardiovascular risk.
25613532 Novel protein biomarker models improve identification of 10-year MI risk above and beyond traditional risk factors with 14% better allocation to either high or low risk group.
25575512 rs3798220 and rs10455872 of LPA are associated with Lp(a)-cholesterol levels.
25490096 Elevated Lp(a) levels have a robust association with mild GFR impairment in type 2 diabetics independent of race, insulin resistance, and albuminuria
25463112 human lipoprotein(a) mice have increased glutathione-based antioxidant status and reduced LDL when treated with ribose-cysteine
25314652 Elevated cardiometabolic risk is conferred by apparently reduced circulating Lp(a) assays supporting the notion that "low" serum Lp(a), mediating autoimmune activation, is a major determinant of cardiometabolic risk.
25208887 Genome-wide association analyses revealed common DNA variants in PLG, LPA, and near SIGLEC14 that contribute to plasma plasminogen level variation.
25142165 Data indicate that complex low density lipoprotein (LDL) could attach through lipoprotein(a) Lp(a) to immobilized form of galectin-1.
24977982 role of lipoprotein A in cardiovascular disease
24972322 Measurement of apo A-I and apo B100 may offer an alternative to high and low density lipoprotein cholesterol (HDL-c and LDL-c) methods for cardiovascular disease risk assessment in dyslipidemic patients [
24937703 Data indicate that lipoprotein (a) Lp(a) is not related to the development of type two diabetes mellitus (T2DM) but may affect clot structure ex vivo without a prolongation of the clot lysis time.
24925971 The LPA null allele (rs41272114) is associated with decreased circulating lipoprotein(a) levels and decreased coronary artery disease risk.
24888427 Low birthweight was shown to be strongly associated with elevated serum levels of Lp(a) in prepubertal children.
24880474 PPARA and PPARG polymorphisms should be involved in the regulation of plasma Lp(a) independently and/or in an interactive manner.
24859635 In African-Americans, apoB and apoB/apoA-1 remained consistently and positively associated with both Lp(a) and allele-specific apo(a) levels
24839811 Lp(a) serum level is significantly higher in patients with ischemic stroke than in patients with head trauma
24790998 This study explored rs9364559 in the LPA gene may be associated with the pathogenesis of CAD; and the risk of CAD might be higher in the population carrying 4 haplotypes of different blocks in the LPA gene.
24781076 In only one out of the four studies the concentration of lipoprotein(a) was found to be higher in migraineurs than in controls
24776095 Study confirmed the association of the LPA rs10455872 with ronary artery disease in a large sample of Brazilian patients.
24760552 Analyses in three independent populations showed significant associations of Lp(a) concentrations, LMW apo(a) phenotypes, and rs10455872 with peripheral arterial disease.
24751932 Progress in the understanding of Lp(a) metabolism has the potential to lead to the development of novel and specific treatments for the reduction of Lp(a) levels and the associated risk of cardiovascular disease.
24632281 Lipoprotein a levels independently predict cardiovascular disease in men and women with familial hypercholesterolemia.
24622370 Low lipoprotein(a) concentrations alone seem not to be causally associated with type 2 diabetes, but a causal association for large lipoprotein(a) isoform size cannot be excluded.
24502962 Elevated Lp(a) levels are associated with dense fibrin clots. Authors found that the association of LPA 4399Met carriers and clot permeability as well as lysis time differ by ethnicity.
24356104 data supported an association between serum Lp(a) levels and short-term prognosis in Chinese patients with acute ischemic stroke
24243886 Among white JUPITER participants treated with potent statin therapy, Lp(a) was a significant determinant of residual risk.
24161323 Lp(a) plasma level significantly associates with the risk of cardiovascular events in patients with established coronary artery disease; however, there exists marked heterogeneity across trials
24092750 Increased plasma lipoprotein(a) level predicts future coronary and cardiovascular events in patients with stable coronary heart disease.
24089516 there is a strong inverse association of Lp(a) levels with risk of T2D. However, a genetic variant that elevated Lp(a) levels was not associated with risk of T2D, suggesting that elevated Lp(a) levels are not causally associated with a lower risk of T2D.
24083682 Lp(a) levels in pregnant women do not differ with respect to the presence or absence of gestational diabetes.
23978127 There is lack of association between lipoprotein(a) genetic variants and subsequent cardiovascular events in Chinese Han patients with coronary artery disease after percutaneous coronary intervention.
23973688 Serum levels of lipoprotein(a) are associated with increased risk of cardiovascular disease despite treatment with niacin and/or simvastatin.
23951216 Levels of Lp(a) positively correlate with CACs among Chinese Han people who are without diabetes and hypertension, suggesting that Lp(a) may be an important risk factor for the presence of calcified atheromas.
23914433 The study suggests a causal relation between Lp(a) and aortic valve disease.
23903772 Results show that individuals with the G allele of rs10455872 in the LPA locus, which represents approximately one in seven patients, have a higher risk of coronary artery disease than the majority of the population even after treatment with statins.
23735648 The percentage of intersubject variability in Lp(a) cholesterol and the percentage of prevalent CAD explained were small.
23701995 Neither the ratio LDL-C/HDL-C nor apoB/apoA-1, or Lp(a) revealed a closer association with coronary artery calcium.
23701863 Adult congenital heart disease patients did not have significantly altered lipoprotein (a) levels.
23667177 association of MCP-1 with OxLDL and Lp(a) may play a role in modulating monocyte trafficking during atherogenesis
23652366 Elevated serum Lp(a) levels are associated with the number of coronary artery plaques and plaque morphology in patients with acute myocardial infarction.
23552902 Identify uric acid and lipoprotein(a) as significant independent markers for vasospastic angina.
23484137 Elevated serum Lp(a) is an independent predictor of coronary artery disease and myocardial infarction. Furthermore, Lp(a) levels should be a marker of restenosis after percutaneous transluminal coronary angioplasty
23388002 Genetic variation in the LPA locus, mediated by Lp(a) levels, is associated with aortic-valve calcification across multiple ethnic groups and with incident clinical aortic stenosis.
23375930 Extreme lipoprotein(a) levels or corresponding LPA KIV-2/rs10455872 risk genotypes substantially improved MI and CHD risk prediction
23357149 Specific Lp(a) apheresis for 18 months produced coronary atherosclerosis regression in stable CHD patients with high Lp(a) levels and reached LDL-C goals.
23243000 Apo(a) induces both nuclear beta-catenin-mediated cyclooxygenase-2 expression and prostaglandin E2 secretion, indicating a proinflammatory role for lipoprotein A.
23202367 Report HIV disease activity modulates lipoprotein(a) and allele-specific apolipoprotein(a) levels and cardiovascular risk.
23183511 Only Lp(a) levels correlated with the extent of coronary artery disease as assessed with coronary angiography in patients treated with lipid lowering therapy.
23165148 there is still no clear role of Lp(a) in either normal or complicated pregnancies.
23137279 Letter: no evidence of relationship of circulating Lp(a) levels or Lp(a) polymorphisms with future venous thromboembolism.
23099120 Two different kinetic apoB pools within Lp(a) and LDL suggest intracellular Lp(a) assembly from apo(a) and newly synthesized LDL.
23040268 There are no therapeutic drugs that selectively target elevated Lp(a), but a number of possible agents are being considered--{review}
23036009 The risk for coronary artery disease in a Chinese Han population is not associated with single nucleotide polymorphisms in the SLC22A3-LPAL2-LPA gene cluster.
23010950 In this cohort, no evident association was found between the lipoprotein(a) plasma levels and the incidence of cancer.
22762941 In conclusion, prothrombotic plasma fibrin clot phenotype related to elevated lipoprotein(a) with smaller apolipoprotein(a) isoforms might represent a novel risk factor for Residual vein obstruction.
22753196 In psoriatic patients, VAP-1 elevation correlated with elevation of Lp (a). This may be responsible for a higher prevalence of cardiovascular accidents in psoriatic patients.
22748161 Results suggest that the age-related increase in the probability of having diabetes is significantly lower in subjects with Lp(a) levels >46 mg/dl.
22710560 Suggest that the oxidative modification of Lp(a) may be associated with arterial stiffness in hypertensive, but not non-hypertensive, female subjects.
22633779 Elevated LP(a) is an independent prognostic risk factor for cardiovascular events.
22633661 Lp(a) on admission is an independent risk factor for adverse cardiovascular events in acute coronary syndrome.
22516069 Lp(a) primarily promotes atherosclerotic stenosis rather than venous thrombosis.
22485129 An association between a low serum lipoprotein A (LpA) levels and all-cause or cancer death, supports the anti-neoplastic effect of LpA.
22422337 elevated Lp(a) levels represent the only risk markers found in isolated pulmonary embolism.
22407494 Lp(a) remained unaltered by resistance training in type 2 diabetes
22387060 serum Lp(a) levels were found to be associated with the severity of aortic atherosclerosis, especially in abdominal aorta, as well as coronary atherosclerosis
22327610 Studies suggest that the application of novel technologies to the long-standing mysteries of Lp(a) biology would provide the opportunity for expanding our understanding of Lp(a) and its complex role in cardiovascular health.
22283971 Conclude that Lp(a) cholesterol is not an independent risk factor for cardiovascular disease in overweight/obese African American children.
22207727 Endogenous estrogens lower plasma PCSK9 and LDL cholesterol but not Lp(a) or bile acid synthesis in women.
22192511 Assessment of KIF6 genotype is not useful in predicting low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
22134617 a possible additional pathophysiological role for AT Basel and elevated lipoprotein(a) level in arterial thrombogenesis.
22010162 2 SNPs in the LPA gene, rs3798220 and rs10455872 are independently associated with Lp(a) levels and with CHD; and rs3798220 may also predict the reduction of cardiovascular events by aspirin therapy.
21986921 Lipoprotein(a) and homocysteine as genetic risk factors for vascular and neuropathic diabetic foot in type 2 diabetes mellitus.
21970553 investigation of role in atherogenesis played by oxLp(a): Serum oxLp(a) may be more closely associated with accelerated carotid atherosclerosis, in comparison to serum Lp(a), in asymptomatic middle-aged/older subjects in Japan.
21914962 Lp(a) levels could predict the progression of the non-culprit coronary lesions after AMI.
21914687 Results suggest that increased Lp(a) levels do not confer cardiovascular risk by promoting early atherogenesis.
21907882 The current study suggests evidence of high Lp(a) concentrations in childhood migraine; perhaps a novel link exists between migraine and stroke.
21802535 Proteomics of Lipoprotein(a) identifies a protein complement associated with response to wounding.
21749171 Genotype-phenotype relationship and impact on atherogenic risk.
21592478 Meta-analysis: revealed no candidate genes from the HumanCVD BeadChip outside the LPA locus to have an effect on Lp(a) levels.
21519277 Healthy young men with positive parental history of premature myocardial infarction have a similar Lp(a) levels but worse lipid profile than women.
21484527 Lp(a) measurements may have a role in risk stratification in cardiovascular disease of Southeast Asians.
21473861 beta-GPI-Lp(a) complex concentrations increased in active RA. Inflammation and oxidative stress in RA contribute to the increase of ox-Lp(a) and subsequently the formation of beta-GPI-Lp(a).
21404224 In hemodialysis patients, OxPL/apoB, lipoprotein(a) and OxLDL biomarkers are not associated with cardiovascular disease.
21300353 demonstrated differential immunoexpression patterns between native Lp(a) and plasminogen, and suggested that Lp(a)-plasminogen interaction may play a part in differential mechanisms in all atherosclerotic lesions of carotid and cerebral arteries
21283670 an unbiased genome-wide admixture scan for frequency-differentiated genetic determinants of Lp(a) level in African Americans
21252144 Lipoprotein(a) may have effects on atherothrombotic vascular disease that are only relevant at specific sites.
21231777 The association of LPA KIV-2 genotypes raising plasma levels of lipoprotein(a) with increased risk of myocardial infarction strongly supports a causal association of lipoprotein(a) with risk of myocardial infarction.
21179199 inhibition of IL-6 signalling decreases Lp (a) serum levels
21153771 Data show that serum lipoprotein (a) levels are significantly higher in women and men with diabetes.
21127300 There are associations between LPA region SNPs and CAAD that appear to be attributable to effects on Lp(a) level.
21086792 Elevated serum Lp(a) concentrations may be compatible with longevity.
21078622 no support for early atherogenic effects of increased Lp(a) levels
20971364 Observational study of gene-disease association. (HuGE Navigator)
20705065 Lp(a) interferes with annexin A5 binding to the procoagulant phosphatidylserine which translocates to the membrane surface under stress condition
20691971 greatly elevated Lp(a) levels may have a role in large artery atherosclerotic stroke and extensive burden of cervicocerebral steno-occlusive lesions
20679960 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20605575 The rs3798220 and rs10455872 SNPs explain the association of the CCTC and CTTG haplotypes with coronary heart disease.
20605575 Observational study of gene-disease association. (HuGE Navigator)
20601648 Observational study of gene-disease association. (HuGE Navigator)
20593350 Ultrapure dialysate can prevent the rise of Lp(a), potentially decreasing the risk of cardiovascular disease in hemodialysis patients.
20580413 Elevated serum Lp(a) does not appear to be associated with recurrent VTE in patients with history of first unprovoked VTE and may not play a role in identifying patients with unprovoked VTE at high risk of recurrence.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20444451 Lp-PLA(2) activity is associated with allele-specific apo(a) levels, but this association differs across African American-Caucasian ethnicity
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20303190 Lipoprotein(a) is a strong independent predictor of coronary artery calcification in type-2 diabetic women, regardless of race, but not in men.
20197188 leptin is negatively associated with size of the apo(a). Subjects with high leptin have smaller, more atherogenic apo(a) than low leptin individuals.
20160194 The proportion of plasma Lp(a) variation provided evidence of linkage disequilibrium between certain LPA SNPs and genomic KIV-2 copy number; and identified similar LPA haplotype block structures.
20160194 Observational study of gene-disease association. (HuGE Navigator)
20143106 A genetic study of a family with CADASIL (cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy and Lp(a) elevation that co-segregated demonstrates the molecular basis of both these traits.
20129383 Long-term treatment LDL-apheresis was at least able to stabilize coronary artery disease in the majority of the individuals with symptomatic HyperLp(a).
20129382 Designed a prospective, randomized, controlled trial to prove the hypothesis that lipid apheresis decreases vascular events in patients with elevated lipoprotein(a).
20129381 A substantially (more than 1100 mg/l) elevated Lp(a) plasma level seems to be an important predictor for the occurrence of cardiovascular events.
20129380 Review: summarizes current studies investigating familial hypercholesterolemia and Lp(a)-hyperlipidemia as independent and combined cardiovascular risk factors, and some promising biomarker candidates for these entities.
20106478 a causal association of lipoprotein(a) with risk of ischemic heart disease (Review)
20036902 Observational study of gene-disease association. (HuGE Navigator)
20032323 Observational study of gene-disease association. (HuGE Navigator)
20026018 existence of beta(2)-GPI-Lp(a) complexes in both controls and systemic lupus erythematosus patients; the complexes levels increase in SLE
20014954 The competing risks of all-cause mortality, cumulative fatal-nonfatal stroke events, cumulative fatal-nonfatal coronary artery disease (CAD) events, and nonfatal stroke or CAD events due to high Lp(a) serum levels, were tested.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19880117 Observational study of gene-disease association. (HuGE Navigator)
19808717 Report a positive association between infrarenal aortic diameters and heavy drinking, as well as lipoprotein (a) levels.
19672030 As the deposition of oxidized Lp(a) was detected in calcified areas of coronary arteries, oxidized Lp(a) might be implicated in endothelial dysfunction
19646429 Elevated ox-Lp(a) levels are associated with presence and severity of ACS, and may be useful for identification of patients with ACS.
19642912 Observational study of gene-disease association. (HuGE Navigator)
19636317 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19572086 increased risk for coronary heart disease with 4399Met allele of LPA
19572086 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19564206 Found that circulating Lp(a) concentrations are likely higher in cases with abdominal aortic aneurysms.
19545557 The fact that ox-Lp(a) and Lp(a)-IC are present in newborns and children suggests that oxidized lipoproteins play an initiating role in atherosclerotic process
19509380 There is a causal association between elevated lipoprotein(a) levels and increased risk of myocardial infarction.
19496273 a marker for coronary heart disease
19479237 Observational study of gene-disease association. (HuGE Navigator)
19349573 Observational study of gene-disease association. (HuGE Navigator)
19348789 findings show the sequence variants from the coding portion of kringle IV types 8-10 of the LPA locus are significantly associated with the TTTTA(n) repetition but still are not able to markedly account for the TTTTA(n) locus effect
19335423 Lp(a) may be a factor contributing to an increased cardiovascular risk in patients with psoriasis
19263529 Observational study of gene-disease association. (HuGE Navigator)
19233690 The association between low levels of LRP5 gene expression and increased levels of Lp(a) in AAA patients suggests a potential role of LRP5 in Lp(a) catabolism.
19222374 is a significant association between Lp(a) and the presence and stage of lung cancer
19208510 Plasma levels of apo(a) and Lp(a) display significant correlations with hepatic status
19198611 Identification of the SLC22A3-LPAL2-LPA gene cluster as a strong susceptibility locus for coronary artery disease.
19198611 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19124843 Results describe a genome-wide association study of plasma Lp(a) in 386 members of a founder population, and identify associations with 77 single nucleotide polymorphisms (SNPs) spanning 12.5 Mb on chromosome 6q26-q27.
19124843 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
19014618 Observational study of gene-disease association. (HuGE Navigator)
18983515 ability of the apo(a) component of Lp(a) to inhibit the key positive feedback step of plasmin-mediated Glu-plasminogen to Lys-plasminogen conversion
18848929 Data show that serum concentrations of PLA(2)-IIA, Lp(a), ICAM-1 and PECAM-1 are higher for patients with unstable rather that stable angina and controls, and that high plasma Lp(a) is an independent risk factor for angina.
18806883 The association between retinal arteriosclerosis and serum Lp(a) and homocysteine (Hcy) levels suggests that Lp(a) as well as Hcy could play a role in the development of retinal arteriosclerosis.
18776185 Apolipoprotein(a), through its strong lysine-binding site in KIV(10'), mediates increased endothelial cell contraction and permeability via a Rho/Rho kinase/MYPT1-dependent pathway.
18775538 carriers of an apolipoprotein(a) variant had elevated Lp(a), doubled cardiovascular risk, and appeared to benefit more from aspirin than non-carriers
18775538 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18682798 Observational study of gene-disease association. (HuGE Navigator)
18682748 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18622136 investigating the relationship between Lp(a) and carotid artery intima-media thickenss levels in relation to metabolic syndrome among older subjects
18599799 Lipoprotein(a) is associated differentially with carotid stenosis, occlusion, and total plaque area.
18594118 unique property of Lp[a] suggests novel insights into its physiological function and mechanisms of atherogenicity
18582452 This study has shown the relationship between apo(a) size and Lp(a), the influence of apo(a) size varying according to the phenotype. Apo(a) "double isoform" phenotype confers elevated levels to Lp(a) in healthy Ivorian subject.
18560444 Genome-wide linkage analysis for identifying quantitative trait loci involved in the regulation of lipoprotein a (Lpa) levels.
18513389 Observational study of gene-disease association. (HuGE Navigator)
18479303 single nucleotide polymorphisms in the apolipoprotein(a) Kringle IV 8 domain are not directly associated with atherothrombotic serum lipoprotei A concentration
18479303 Observational study of gene-disease association. (HuGE Navigator)
18464913 Observational study of gene-disease association. (HuGE Navigator)
18386550 Observational study of gene-disease association. (HuGE Navigator)
18304554 cardiovascular risk factor apolipoprotein(a) gene linkage disequilibrium differed between African Americans and Caucasians at three apo(a) gene polymorphisms.
18280807 Elevated lipoprotein Lp(a) levels confer genetic predisposition to coronary artery disease in young Asian Indians.
18198982 Study suggests that elevated Lp(a) level is an independent risk factor of coronary heart disease (CHD) in carriers of other important CHD risk factors.
18163888 human apolipoprotein(a) carboxyl-terminal kringle IV-10-kringle V fusion protein is an effective inhibitor of angiogenesis and angiogenesis-dependent tumor growth.
18086931 observed a stepwise increase in risk of MI with increasing levels of lipoprotein(a), with no evidence of a threshold effect
17975119 Observational study of gene-disease association. (HuGE Navigator)
17942087 Observational study of gene-disease association. (HuGE Navigator)
17942087 study shows that the 93T allele of the LPA gene is associated with a reduced risk of peripheral arterial disease and low Lp(a) levels
17923276 The relationship between LPA and thyroid function status in the general population was studied.
17908332 Lp(a) concentration was significantly lower and negatively correlated with triglycerides among Omani diabetic compared to non-diabetic subjects.
17845920 Aspirin lowers the increased Lp(a) levels in patients with ischemic stroke.
17683612 Lipoprotein a polymorphism may confer a potential risk for cardiovascular disease.
17603063 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17603063 lower Lipoprotein A (LPA) concentrations were observed in subjects carrying the T allele of the Liproprotein A 93C>T polymorphism and consuming a high intake of fish
17569884 Observational study of gene-disease association. (HuGE Navigator)
17569884 The LPA I4399M Single Nucleotide Polymorphism is associated with severe Coronary Artery Disease and plasma lipoprotein(a) levels
17537433 Data show that galectin-1, an endogenous lectin produced by arterial cells, binds lipoprotein(a) [Lp(a)] in situ.
17478739 This meta-analysis suggests that elevated Lp(a) is a risk factor for incident stroke.
17462619 Major 5-polymorphic compound genotypes are not associated with restricted range of Lp(a) levels.
17460176 Lp(a) lipoprotein levels do not have a clear role in development of coronary artery disease in older men
17145597 In a relatively small population of elderly subjects, the association of high lipoprotein(a) and fibrinogen levels appears to carry an increased risk of pooled coronary heart disease and stroke mortality.
16893192 Cultured human hepatoma cells secrete an oxidase activity that dramatically enhances the rate of covalent Lp(a) assembly.
16840570 Observational study of gene-disease association. (HuGE Navigator)
16840570 Multiple low-prevalence alleles in LPA can account for the large between-population difference in serum Lp(a) levels between European Americans and African Americans.
16625232 The finding of high levels of LP(a) and MDA with low levels of nitric oxide in the peripheral and cavernous venous blood of diabetic men with erectile dysfunction (ED)correlates strongly with severity of ED as measured by PPDU
16497311 elevated Lp(a) levels alone do not contribute to increased cardiovascular risk by promoting early atherogenesis in vivo
16403785 data demonstrate that Lp(a), via its apo(a) moiety, is a ligand for the beta2-integrin Mac-1, thereby facilitating inflammatory cell recruitment to atherosclerotic plaques; these observations suggest a novel mechanism for atherogenic properties of Lp(a)
16202171 Suggest connection between peroxisomal enzyme activity & presence of human LPA gene in murine genome. Effect may be result of changes in oxidative processes in lipid metabolism rather than from direct effect of LPA gene on peroximal gene expression.
16197951 Lp(a) levels and Apo(a) isoforms may have roles in ischaemic stroke in the elderly
16150826 binding sites responsible for binding to fibronection
16122830 Lp (a) levels may have a pathogenetic role in the development of gangrenous foot lesions in patients with diabetes mellitus.
16113787 lipoprotein(a) has a role in homocysteine-enhanced antifibrinolysis in human plasma
16053196 Observational study of gene-disease association. (HuGE Navigator)
15983325 Lp(a) is an independent risk factor for the progression of diabetic nephropathy in type 2 diabetic patients with overt proteinuria.
15905467 high levels of apo(a)/Lp(a), perhaps acting via a specific cell-surface binding domain, inhibit hepatic clearance of remnants, leading to high plasma levels of remnant lipoproteins and markedly enhanced atherosclerosis
15708348 Data suggest that laminin may bind to apolipoprotein (a) in the atherosclerotic intima, thus contributing to the selective retention of lipoprotein (a) in this milieu.
15654123 mechanism by which increased circulating levels of Lp[a] could contribute to atherogenesis
15543335 Stimulation of PMNs by apo(a) results in the formation of elastase-derived apo(a) fragments that produce a concentration-dependent decrease in the formation of plasmin
15515480 Changes in Lp(a) levels were found and perhaps these changes may be related to the episodic inflammation affecting patients on hemodialysis.
15479125 Our findings suggest that Lp(a) is more strongly associated with aCAD+ in women than in men.
15258620 Observational study of gene-disease association. (HuGE Navigator)
15041277 apo(a) mediates the Lp(a)-induced biphasic response in platelet c-AMP as the result of platelet exposure to increasing levels of Lp(a), up to a concentration of 25 mg/dl Lp(a)
14746139 Observational study of genotype prevalence. (HuGE Navigator)
12940514 Blood levels are higher in coronary artery disease patients compared with normal values.
12738397 Lp(a) and apo(a) polymorphisms do not appear to be reliable markers of restenosis in patients with Type 2 diabetes mellitus.
12578871 Observational study of gene-disease association. (HuGE Navigator)
12482643 Positive correlation of Lp(a) between type 2 diabetic patients and their offspring, suggesting a potential genetic control for Lp(a) levels in type 2 diabetics families.
12359323 Observational study of gene-disease association. (HuGE Navigator)
12220441 Observational study of genotype prevalence. (HuGE Navigator)
12127051 Observational study of gene-disease association. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11999088 Plasma lipoprotein (a) levels are significantly elevated in patients with coronary artery disease as compared to controls. The contribution of lipoprotein (a) phenotype to the lipoprotein (a) levels in our population, if any, is modest.
11947970 Type of diabetes and waist-hip ratio are important determinants of levels in diabetic patients [LIPOPROTEIN (A)]
11865151 Lipoprotein (a) promotes large vessel atheromatosis rather than small vessel arteriolosclerosis and favors thrombosis on atheromatous plaques by suppressing local fibrinolysis.
11833851 data suggest that Lp(a) and peroxidative stress may be involved as cofactors in essential hypertension, with a mechanism that remains to be elucidated
11822583 children's group with BMI > 30 and with family history of CVD presented higher levels in comparison to the less obese group with family history of CVD
11485023 Observational study of gene-disease association. (HuGE Navigator)
11440434 Observational study of gene-disease association. (HuGE Navigator)
11332648 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11126727 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEHKEVVLLLLLFLKSAAPEQSHVVQDCYHGDGQSYRGTYSTTVTGRTCQAWSSMTPHQHNRTTENYPNA      1 - 70
GLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQ     71 - 140
ECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVR    141 - 210
WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAW    211 - 280
SSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVP    281 - 350
SLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCR    351 - 420
NPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQ    421 - 490
SYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQ    491 - 560
CSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSH    561 - 630
SRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQ    631 - 700
APTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAP    701 - 770
YCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYST    771 - 840
TVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTA    841 - 910
VAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYP    911 - 980
NAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPG    981 - 1050
VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPG   1051 - 1120
VRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQ   1121 - 1190
AWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP   1191 - 1260
VPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNY   1261 - 1330
CRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGN   1331 - 1400
GQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNL   1401 - 1470
TQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPH   1471 - 1540
SHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPS   1541 - 1610
EQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVA   1611 - 1680
APYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTY   1681 - 1750
STTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEG   1751 - 1820
TAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY   1821 - 1890
YPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQR   1891 - 1960
PGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRD   1961 - 2030
PGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRT   2031 - 2100
CQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTV   2101 - 2170
TPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIM   2171 - 2240
NYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYH   2241 - 2310
GNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYC   2311 - 2380
NLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMT   2381 - 2450
PHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA   2451 - 2520
PSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDA   2521 - 2590
VAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRG   2591 - 2660
TYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDA   2661 - 2730
EGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTP   2731 - 2800
EYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTE   2801 - 2870
QRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYT   2871 - 2940
RDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTG   2941 - 3010
RTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPP   3011 - 3080
TVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL   3081 - 3150
IMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQEC   3151 - 3220
YHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWE   3221 - 3290
YCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSS   3291 - 3360
MTPHSHSRTPEYYPNAGLIMNYCRNPDPVAAPYCYTRDPSVRWEYCNLTQCSDAEGTAVAPPTITPIPSL   3361 - 3430
EAPSEQAPTEQRPGVQECYHGNGQSYQGTYFITVTGRTCQAWSSMTPHSHSRTPAYYPNAGLIKNYCRNP   3431 - 3500
DPVAAPWCYTTDPSVRWEYCNLTRCSDAEWTAFVPPNVILAPSLEAFFEQALTEETPGVQDCYYHYGQSY   3501 - 3570
RGTYSTTVTGRTCQAWSSMTPHQHSRTPENYPNAGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCL   3571 - 3640
VTESSVLATLTVVPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQR   3641 - 3710
TTEYYPNGGLTRNYCRNPDAEISPWCYTMDPNVRWEYCNLTQCPVTESSVLATSTAVSEQAPTEQSPTVQ   3711 - 3780
DCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGLTRNYCRNPDAEIRPWCYTMDPSVR   3781 - 3850
WEYCNLTQCPVMESTLLTTPTVVPVPSTELPSEEAPTENSTGVQDCYRGDGQSYRGTLSTTITGRTCQSW   3851 - 3920
SSMTPHWHRRIPLYYPNAGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTRCPVTESSVLTTPTVAPVP   3921 - 3990
STEAPSEQAPPEKSPVVQDCYHGDGRSYRGISSTTVTGRTCQSWSSMIPHWHQRTPENYPNAGLTENYCR   3991 - 4060
NPDSGKQPWCYTTDPCVRWEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHGNGQ   4061 - 4130
SYRGTFSTTVTGRTCQSWSSMTPHRHQRTPENYPNDGLTMNYCRNPDADTGPWCFTMDPSIRWEYCNLTR   4131 - 4200
CSDTEGTVVAPPTVIQVPSLGPPSEQDCMFGNGKGYRGKKATTVTGTPCQEWAAQEPHRHSTFIPGTNKW   4201 - 4270
AGLEKNYCRNPDGDINGPWCYTMNPRKLFDYCDIPLCASSSFDCGKPQVEPKKCPGSIVGGCVAHPHSWP   4271 - 4340
WQVSLRTRFGKHFCGGTLISPEWVLTAAHCLKKSSRPSSYKVILGAHQEVNLESHVQEIEVSRLFLEPTQ   4341 - 4410
ADIALLKLSRPAVITDKVMPACLPSPDYMVTARTECYITGWGETQGTFGTGLLKEAQLLVIENEVCNHYK   4411 - 4480
YICAEHLARGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYARVSRFVTWIEGMMRNN     4481 - 4548
//

Text Mined References (289)

PMID Year Title
27005778 2016 Genome-wide study for circulating metabolites identifies 62 loci and reveals novel systemic effects of LPA.
26975530 2016 Distinct metabolism of apolipoproteins (a) and B-100 within plasma lipoprotein(a).
26900838 2016 Apolipoprotein(a) Kringle-IV Type 2 Copy Number Variation Is Associated with Venous Thromboembolism.
26776177 2016 TESTING POPULATION-SPECIFIC QUANTITATIVE TRAIT ASSOCIATIONS FOR CLINICAL OUTCOME RELEVANCE IN A BIOREPOSITORY LINKED TO ELECTRONIC HEALTH RECORDS: LPA AND MYOCARDIAL INFARCTION IN AFRICAN AMERICANS.
26710333 2016 Plasma lipoprotein(a) predicts major cardiovascular events in patients with chronic kidney disease who undergo percutaneous coronary intervention.
26632531 2016 Lipoprotein(a) in Familial Hypercholesterolemia With Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Gain-of-Function Mutations.
26546997 2016 An Increased Serum Level of Lipoprotein(a) Is a Predictor for Deep Vein Thrombosis in Patients with Spinal Cord Injuries.
26518096 2016 Sex and ethnic differences in the associations between lipoprotein(a) and peripheral arterial disease in the Multi-Ethnic Study of Atherosclerosis.
26515419 2015 Effects of extended-release niacin on the postprandial metabolism of Lp(a) and ApoB-100-containing lipoproteins in statin-treated men with type 2 diabetes mellitus.
26412029 Plasma proprotein convertase subtilisin/kexin type 9 is associated with Lp(a) in type 2 diabetic patients.
26407666 2015 Ox-Lp(a) transiently induces HUVEC autophagy via an ROS-dependent PAPR-1-LKB1-AMPK-mTOR pathway.
26377243 2015 Genome- and exome-wide association study of serum lipoprotein (a) in the Jackson Heart Study.
26361154 2015 Oxidized Phospholipids, Lipoprotein(a), and Progression of Calcific Aortic Valve Stenosis.
26302166 2015 Lack of association of rs3798220 with small apolipoprotein(a) isoforms and high lipoprotein(a) levels in East and Southeast Asians.
26298741 2015 Lipoprotein (a) as a risk factor for ischemic stroke: a meta-analysis.
26224810 2015 Autotaxin Derived From Lipoprotein(a) and Valve Interstitial Cells Promotes Inflammation and Mineralization of the Aortic Valve.
26222903 2015 Lipoprotein (a) levels are not associated with carotid plaques and carotid intima media thickness in statin-treated patients with familial hypercholesterolemia.
26147378 2015 Production of Cloned Miniature Pigs Expressing High Levels of Human Apolipoprotein(a) in Plasma.
25938632 2015 Elevated Lipoprotein(a) Does Not Cause Low-Grade Inflammation Despite Causal Association With Aortic Valve Stenosis and Myocardial Infarction: A Study of 100,578 Individuals from the General Population.
25936334 2015 An elevated lipoprotein(a) plasma level as a cardiovascular risk factor.
25936330 2015 Effects of Lipoprotein apheresis on the Lipoprotein(a) levels in the long run.
25936321 2015 Specific Lipoprotein(a) apheresis attenuates progression of carotid intima-media thickness in coronary heart disease patients with high lipoprotein(a) levels.
25936320 2015 Efficacy, safety, and tolerability of long-term lipoprotein apheresis in patients with LDL- or Lp(a) hyperlipoproteinemia: Findings gathered from more than 36,000 treatments at one center in Germany.
25936312 2015 The impact of lipoprotein apheresis in patients with refractory angina and raised lipoprotein(a): Objectives and methods of a randomised controlled trial.
25936305 2015 Lowering of lipoprotein(a) level under niacin treatment is dependent on apolipoprotein(a) phenotype.
25871336 2015 Plasma lipoprotein(a) levels and atherosclerotic renal artery stenosis in hypertensive patients.
25865336 2015 Impact of high lipoprotein(a) levels on in-stent restenosis and long-term clinical outcomes of angina pectoris patients undergoing percutaneous coronary intervention with drug-eluting stents in Asian population.
25861813 2015 Role of lipoprotein(a) in predicting the severity of new on-set coronary artery disease in type 2 diabetics: A Gensini score evaluation.
25852127 2015 Lipoprotein (a) upregulates ABCA1 in liver cells via scavenger receptor-B1 through its oxidized phospholipids.
25810300 2015 Race is a key variable in assigning lipoprotein(a) cutoff values for coronary heart disease risk assessment: the Multi-Ethnic Study of Atherosclerosis.
25778403 2015 Lipoprotein(a) catabolism is regulated by proprotein convertase subtilisin/kexin type 9 through the low density lipoprotein receptor.
25676008 2015 Evaluation of adiponectin and lipoprotein(a) levels in cardiac syndrome X.
25649924 2015 Serum lipoprotein (a) concentrations are inversely associated with T2D, prediabetes, and insulin resistance in a middle-aged and elderly Chinese population.
25633186 2015 Immunopathology of desialylation: human plasma lipoprotein(a) and circulating anti-carbohydrate antibodies form immune complexes that recognize host cells.
25614280 2015 Mipomersen, an antisense oligonucleotide to apolipoprotein B-100, reduces lipoprotein(a) in various populations with hypercholesterolemia: results of 4 phase III trials.
25613532 2015 Clinically significant novel biomarkers for prediction of first ever myocardial infarction: the Tromsø Study.
25575512 2015 Evidence for several independent genetic variants affecting lipoprotein (a) cholesterol levels.
25490096 2014 Plasma lipoprotein(a) levels are associated with mild renal impairment in type 2 diabetics independent of albuminuria.
25463112 2014 Ribose-cysteine increases glutathione-based antioxidant status and reduces LDL in human lipoprotein(a) mice.
25350695 2014 Pharmacogenetic meta-analysis of genome-wide association studies of LDL cholesterol response to statins.
25314652 2015 Low "quotient" Lp(a) concentration mediates autoimmune activation and independently predicts cardiometabolic risk.
25208887 2014 Genetic variants in PLG, LPA, and SIGLEC 14 as well as smoking contribute to plasma plasminogen levels.
25142165 2014 Circulating Lp(a):LDL complexes contain LDL molecules proportionate to Lp(a) size and bind to galectin-1: a possible route for LDL entry into cells.
24977982 2014 Lipoprotein (a): gene genie.
24972322 2014 Metrological traceability in mass spectrometry-based targeted protein quantitation: a proof-of-principle study for serum apolipoproteins A-I and B100.
24937703 2014 Lp(a) is not associated with diabetes but affects fibrinolysis and clot structure ex vivo.
24925971 2014 A common LPA null allele associates with lower lipoprotein(a) levels and coronary artery disease risk.
24888427 2014 Low birthweight and elevated levels of lipoprotein(a) in prepubertal children.
24880474 2014 Analysis on the association between PPAR?/? polymorphisms and lipoprotein(a) in a Chinese Han population.
24859635 2014 Significant associations between lipoprotein(a) and corrected apolipoprotein B-100 levels in African-Americans.
24839811 2014 Comparison of serum lipoprotein (a) level between non-cardioembolic ischemic stroke and traumatic brain injury.
24790998 2014 The association between the LPA gene polymorphism and coronary artery disease in Chinese Han population.
24781076 2015 Epidemiological association between migraine and lipoprotein(a): a systematic review.
24776095 2014 LPA rs10455872 polymorphism is associated with coronary lesions in Brazilian patients submitted to coronary angiography.
24760552 2014 Lipoprotein (a) concentrations, apolipoprotein (a) phenotypes, and peripheral arterial disease in three independent cohorts.
24751932 2014 Lipoprotein(a) metabolism.
24632281 2014 Lipoprotein(a) levels in familial hypercholesterolemia: an important predictor of cardiovascular disease independent of the type of LDL receptor mutation.
24622370 2013 Lipoprotein(a) concentrations, isoform size, and risk of type 2 diabetes: a Mendelian randomisation study.
24502962 2014 Lipoprotein (a), LPA Ile4399Met, and fibrin clot properties.
24356104 2014 Prognostic value of serum lipoprotein(a) levels in patients with acute ischemic stroke.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24243886 2014 Lipoprotein(a) concentrations, rosuvastatin therapy, and residual vascular risk: an analysis from the JUPITER Trial (Justification for the Use of Statins in Prevention: an Intervention Trial Evaluating Rosuvastatin).
24161323 2014 Lipoprotein(a) for risk assessment in patients with established coronary artery disease.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24092750 2013 Plasma lipoprotein(a) concentration predicts future coronary and cardiovascular events in patients with stable coronary heart disease.
24089516 2014 The association between circulating lipoprotein(a) and type 2 diabetes: is it causal?
24083682 2013 Lipoprotein(a) is not related to markers of insulin resistance in pregnancy.
23978127 2013 Lack of association between lipoprotein(a) genetic variants and subsequent cardiovascular events in Chinese Han patients with coronary artery disease after percutaneous coronary intervention.
23973688 2013 Relationship of apolipoproteins A-1 and B, and lipoprotein(a) to cardiovascular outcomes: the AIM-HIGH trial (Atherothrombosis Intervention in Metabolic Syndrome with Low HDL/High Triglyceride and Impact on Global Health Outcomes).
23951216 2013 Serum lipoprotein(a) positively correlates with coronary artery calcification in low-risk chinese han patients: a study from a single center.
23914433 2013 From the National Heart, Lung, and Blood Institute (NHLBI): researchers find gene variant linked to aortic valve disease.
23903772 2013 Robust association of the LPA locus with low-density lipoprotein cholesterol lowering response to statin treatment in a meta-analysis of 30 467 individuals from both randomized control trials and observational studies and association with coronary artery disease outcome during statin treatment.
23735648 2013 Validation and quantification of genetic determinants of lipoprotein-a levels and predictive value for angiographic coronary artery disease.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23701995 2013 Gender-specific association of coronary artery calcium and lipoprotein parameters: the Heinz Nixdorf Recall Study.
23701863 Lipoprotein(a) concentrations in adult congenital heart disease patients.
23667177 2013 MCP-1 binds to oxidized LDL and is carried by lipoprotein(a) in human plasma.
23652366 2013 Lipoprotein(a) is an important factor to determine coronary artery plaque morphology in patients with acute myocardial infarction.
23552902 2014 Higher serum uric acid and lipoprotein(a) are correlated with coronary spasm.
23484137 2013 Lipoprotein(a) in cardiovascular diseases.
23388002 2013 Genetic associations with valvular calcification and aortic stenosis.
23375930 2013 Extreme lipoprotein(a) levels and improved cardiovascular risk prediction.
23357149 2013 Effect of specific lipoprotein(a) apheresis on coronary atherosclerosis regression assessed by quantitative coronary angiography.
23243000 2013 Apolipoprotein(a) stimulates nuclear translocation of ?-catenin: a novel pathogenic mechanism for lipoprotein(a).
23202367 2013 HIV disease activity as a modulator of lipoprotein(a) and allele-specific apolipoprotein(a) levels.
23183511 2012 Correlation of lipoprotein (a) concentration with the extent of coronary artery disease in patients on lipid lowering therapy.
23165148 2013 The current status of lipoprotein (a) in pregnancy: a literature review.
23137279 2013 Lipoprotein(a), polymorphisms in the LPA gene, and incident venous thromboembolism among 21483 women.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
23099120 2012 In vivo stable-isotope kinetic study suggests intracellular assembly of lipoprotein(a).
23040268 2013 Lipoprotein(a) metabolism: potential sites for therapeutic targets.
23036009 2012 Lack of association between four SNPs in the SLC22A3-LPAL2-LPA gene cluster and coronary artery disease in a Chinese Han population: a case control study.
23010950 2013 Lipoprotein(a) plasma levels and the risk of cancer: the PRIME study.
22762941 2012 Altered fibrin clot properties are associated with residual vein obstruction: effects of lipoprotein(a) and apolipoprotein(a) isoform.
22753196 2013 Serum lipid profile in psoriatic patients: correlation between vascular adhesion protein 1 and lipoprotein (a).
22748161 2012 High levels of lipoprotein(a) are associated with a lower prevalence of diabetes with advancing age: results of a cross-sectional epidemiological survey in Gran Canaria, Spain.
22710560 2013 Oxidized lipoprotein(a) and cardio-ankle vascular index (CAVI) in hypertensive subjects.
22633779 2013 Prognostic significance of elevated lipoprotein(a) in coronary artery revascularization patients.
22633661 2012 Association between Lipoprotein (a) level on admission and the incidence of subsequent cardiovascular events in patients with acute coronary syndrome.
22516069 2012 Genetic evidence that lipoprotein(a) associates with atherosclerotic stenosis rather than venous thrombosis.
22485129 2012 Low lipoprotein(a) concentration is associated with cancer and all-cause deaths: a population-based cohort study (the JMS cohort study).
22422337 2012 The thrombophilic pattern of different clinical manifestations of venous thromboembolism: a survey of 443 cases of venous thromboembolism.
22407494 2012 The effects of resistance training on ApoB/ApoA-I ratio, Lp(a) and inflammatory markers in patients with type 2 diabetes.
22387060 2012 Associations between serum lipoprotein(a) levels and the severity of coronary and aortic atherosclerosis.
22368281 2012 Genome-wide association study of genetic determinants of LDL-c response to atorvastatin therapy: importance of Lp(a).
22331829 2012 Genetic determinants of statin-induced low-density lipoprotein cholesterol reduction: the Justification for the Use of Statins in Prevention: an Intervention Trial Evaluating Rosuvastatin (JUPITER) trial.
22327610 2012 Lipoprotein(a): more interesting than ever after 50 years.
22283971 2012 Lp(a)-cholesterol is associated with HDL-cholesterol in overweight and obese African American children and is not an independent risk factor for CVD.
22207727 2012 Endogenous estrogens lower plasma PCSK9 and LDL cholesterol but not Lp(a) or bile acid synthesis in women.
22192511 2012 KIF6, LPA, TAS2R50, and VAMP8 genetic variation, low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
22134617 2012 Recurrent arterial thrombosis associated with the antithrombin basel variant and elevated lipoprotein(a) plasma level in an adolescent patient.
22010162 2011 Genetic variants in the apolipoprotein(a) gene and coronary heart disease.
21986921 2012 Lipoprotein(a) and homocysteine as genetic risk factors for vascular and neuropathic diabetic foot in type 2 diabetes mellitus.
21970553 2011 The relationship between oxidized lipoprotein(a) and carotid atherosclerosis in asymptomatic subjects: a comparison with native lipoprotein(a).
21914962 2011 Usefulness of Lipoprotein (a) for predicting progression of non-culprit coronary lesions after acute myocardial infarction.
21914687 2012 Relationship between lipoprotein(a) concentrations and intima-media thickness: a healthy population study.
21907882 2011 Lipoprotein a levels in pediatric migraine.
21900290 2012 Genetic variants, plasma lipoprotein(a) levels, and risk of cardiovascular morbidity and mortality among two prospective cohorts of type 2 diabetes.
21802535 2011 Proteomics of Lipoprotein(a) identifies a protein complement associated with response to wounding.
21749171 2011 Lipoprotein(a): genotype-phenotype relationship and impact on atherogenic risk.
21592478 2011 Meta analysis of candidate gene variants outside the LPA locus with Lp(a) plasma levels in 14,500 participants of six White European cohorts.
21519277 2011 Lipoprotein(a) concentration does not differ between sexes in healthy offspring of patients with premature myocardial infarction.
21493818 2011 Genetic and clinical correlates of early-outgrowth colony-forming units.
21484527 2011 Abnormal lipoprotein(a) levels predict coronary artery calcification in Southeast Asians but not in Caucasians: use of noninvasive imaging for evaluation of an emerging risk factor.
21473861 2011 Increased serum levels of ??-GPI-Lp(a) complexes and their association with premature atherosclerosis in patients with rheumatoid arthritis.
21404224 OxPL/apoB, lipoprotein(a) and OxLDL biomarkers and cardiovascular disease in chronic hemodialysis patients.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21300353 2011 Differential expression of oxidized/native lipoprotein(a) and plasminogen in human carotid and cerebral artery plaques.
21283670 2011 Single-nucleotide polymorphisms in LPA explain most of the ancestry-specific variation in Lp(a) levels in African Americans.
21252144 2011 Lipoprotein(a) genetic variants associated with coronary and peripheral vascular disease but not with stroke risk in the Heart Protection Study.
21231777 2011 Lipoprotein(a) and risk of myocardial infarction--genetic epidemiologic evidence of causality.
21179199 2010 Effects of inhibition of interleukin-6 signalling on insulin sensitivity and lipoprotein (a) levels in human subjects with rheumatoid diseases.
21153771 2011 Serum lipoprotein(a) levels are greater in female than male patients with type-2 diabetes.
21149283 2011 Novel association to the proprotein convertase PCSK7 gene locus revealed by analysing soluble transferrin receptor (sTfR) levels.
21127300 2011 Genetic variation in LPAL2, LPA, and PLG predicts plasma lipoprotein(a) level and carotid artery disease risk.
21086792 2010 Lipoprotein(a) and ageing.
21078622 2011 Conventional and Mendelian randomization analyses suggest no association between lipoprotein(a) and early atherosclerosis: the Young Finns Study.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20705065 2010 Effect of lipoprotein (a) on annexin A5 binding to cell membrane.
20691971 2010 Elevated serum lipoprotein(a) as a potential predictor for combined intracranial and extracranial artery stenosis in patients with ischemic stroke.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20605575 2010 Single variants can explain the association between coronary heart disease and haplotypes in the apolipoprotein(a) locus.
20601648 2010 Lipoprotein(a) levels and long-term cardiovascular risk in the contemporary era of statin therapy.
20593350 2010 Conventional versus ultrapure dialysate for lowering serum lipoprotein(a) levels in patients on long-term hemodialysis: a randomized trial.
20580413 2010 Serum lipoprotein (a) levels in patients with first unprovoked venous thromboembolism is not associated with subsequent risk of recurrent VTE.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20444451 2010 Association of Lp-PLA(2) activity with allele-specific Lp(a) levels in a bi-ethnic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20303190 2011 Lipoprotein(a) is strongly associated with coronary artery calcification in type-2 diabetic women.
20197188 2010 Leptin is associated with the size of the apolipoprotein(a) particle in African tribal populations living on fish or vegetarian diet.
20160194 2010 Comprehensive analysis of genomic variation in the LPA locus and its relationship to plasma lipoprotein(a) in South Asians, Chinese, and European Caucasians.
20143106 2010 Clinical and genetic features in a family with CADASIL and high lipoprotein (a) values.
20129383 2009 Treatment of symptomatic HyperLp(a)lipoproteinemia with LDL-apheresis: a multicentre study.
20129382 2009 Designing a study to evaluate the effect of apheresis in patients with elevated lipoprotein(a).
20129381 2009 Cardiovascular events in patients with increased lipoprotein (a) - retrospective data analysis in an outpatient department of lipid disorders.
20129380 2009 Familial hypercholesterolemia and lipoprotein(a) hyperlipidemia as independent and combined cardiovascular risk factors.
20106478 2010 Lipoprotein(a) and ischemic heart disease--a causal association? A review.
20036902 2010 Hemostatic gene polymorphisms in young Sardinian with non-fatal acute myocardial infarction.
20032323 2009 Genetic variants associated with Lp(a) lipoprotein level and coronary disease.
20026018 2010 Detection of serum beta(2)-GPI-Lp(a) complexes in patients with systemic lupus erythematosus.
20014954 2009 All-cause mortality and competing risks of fatal and nonfatal vascular events in the Italian longitudinal study on aging: impact of lipoprotein(a).
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19880117 2010 The I4399M variant of apolipoprotein(a) is associated with increased oxidized phospholipids on apolipoprotein B-100 particles.
19808717 2009 Relationship of heavy drinking, lipoprotein (a) and lipid profile to infrarenal aortic diameter.
19672030 2009 Association of serum oxidized lipoprotein(a) concentration with coronary artery disease: potential role of oxidized lipoprotein(a) in the vasucular wall.
19646429 2009 Elevated concentrations of oxidized lipoprotein(a) are associated with the presence and severity of acute coronary syndromes.
19642912 2009 Lipid profiles and associated gene polymorphisms in young Asian Indian patients with acute myocardial infarction and the metabolic syndrome.
19636317 2009 Decrease of Lp(a) during weight reduction in obese children is modified by the apo(a) kringle-IV copy number variation.
19572086 2009 Coronary heart disease risk, aspirin use, and apolipoprotein(a) 4399Met allele in the Atherosclerosis Risk in Communities (ARIC) study.
19564206 2009 Circulating lipoprotein(a) concentrations and abdominal aortic aneurysm presence.
19545557 2009 Plasma oxidized lipoprotein(a) and its immune complexes are present in newborns and children.
19509380 2009 Genetically elevated lipoprotein(a) and increased risk of myocardial infarction.
19496273 1994 Lipoprotein(a) as a marker for coronary heart disease.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19349573 2009 Lipoprotein(a) levels in obese Portuguese children and adolescents: contribution of the pentanucleotide repeat (TTTTA)n polymorphism in the apolipoprotein(a) gene.
19348789 2009 The apo(a) gene (TTTTA)n promoter polymorphism and its association with variability in exons of the kringle IV types 8 to 10.
19335423 2009 Lipoprotein (a) in patients with psoriasis: associations with lipid profiles and disease severity.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19233690 2009 Gene expression profiling of peripheral blood in patients with abdominal aortic aneurysm.
19222374 2009 Lipoprotein(a) level and its association with tumor stage in male patients with primary lung cancer.
19208510 2009 Mechanisms and significance of lipoprotein(a) in hepatocellular carcinoma.
19198611 2009 Genome-wide haplotype association study identifies the SLC22A3-LPAL2-LPA gene cluster as a risk locus for coronary artery disease.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19124843 2009 Genome-wide association study of plasma lipoprotein(a) levels identifies multiple genes on chromosome 6q.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
19014618 2008 Apolipoprotein gene polymorphisms and plasma levels in healthy Tunisians and patients with coronary artery disease.
18983515 2008 Apolipoprotein(a) inhibits the conversion of Glu-plasminogen to Lys-plasminogen: a novel mechanism for lipoprotein(a)-mediated inhibition of plasminogen activation.
18848929 2008 Circulating secretory type IIA phospholipase A2, lipoprotein (a) and soluble cellular adhesion molecule levels in patients with angina pectoris.
18806883 2008 Lipoprotein(a), homocysteine, and retinal arteriosclerosis.
18776185 2008 Apolipoprotein(a), through its strong lysine-binding site in KIV(10'), mediates increased endothelial cell contraction and permeability via a Rho/Rho kinase/MYPT1-dependent pathway.
18775538 2009 Polymorphism in the apolipoprotein(a) gene, plasma lipoprotein(a), cardiovascular disease, and low-dose aspirin therapy.
18682798 2008 Genes to diseases (G2D) computational method to identify asthma candidate genes.
18682748 2008 Analysis of 17,576 potentially functional SNPs in three case-control studies of myocardial infarction.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18622136 2008 Relationship between lipoprotein(a), metabolic syndrome, and carotid atherosclerosis in older Japanese people.
18599799 2008 Lipoprotein(a) is associated differentially with carotid stenosis, occlusion, and total plaque area.
18594118 2008 A novel function of lipoprotein [a] as a preferential carrier of oxidized phospholipids in human plasma.
18582452 2008 Relationship between apo(a) length polymorphism and lipoprotein(a) concentration in healthy Ivorian subjects with single or double apo(a) isoforms.
18560444 2008 Genome-wide linkage analysis for identifying quantitative trait loci involved in the regulation of lipoprotein a (Lpa) levels.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18479303 2008 Single nucleotide polymorphisms in the apo(a) kringle IV type 8 domain are not associated with atherothrombotic serum lipoprotein (a) concentration, in a Portuguese paediatric population.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18386550 2008 Analysis of polymorphisms in the 5'-flanking region of the apolipoprotein(a) [Apo(a)] gene in Thai subjects with coronary artery diseases.
18304554 2008 The apolipoprotein(a) gene: linkage disequilibria at three loci differs in African Americans and Caucasians.
18280807 2008 Association between lipoprotein(a) levels, apo(a) isoforms and family history of premature CAD in young Asian Indians.
18198982 2008 Lipoprotein(a) and its position among other risk factors of atherosclerosis.
18163888 2008 Secreted human apolipoprotein(a) kringle IV-10 and kringle V inhibit angiogenesis and xenografted tumor growth.
18086931 2008 Extreme lipoprotein(a) levels and risk of myocardial infarction in the general population: the Copenhagen City Heart Study.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17942087 2008 The LPA gene C93T polymorphism influences plasma lipoprotein(a) levels and is independently associated with susceptibility to peripheral arterial disease.
17923276 2007 Relationship between lipoprotein(a) and thyroid function status in the general population.
17908332 2007 Lipoprotein(a): an independent risk factor for ischemic heart disease that is dependent on triglycerides in subjects with type 2 diabetes mellitus.
17845920 Effect of aspirin on lipoprotein(a) in patients with ischemic stroke.
17683612 2007 ApolipoproteinA1-75 G/A (M1-) polymorphism and lipoprotein(a); anti- vs. pro-Atherogenic properties.
17603063 2007 Fish intake and LPA 93C>T polymorphism: gene-environment interaction in modulating lipoprotein (a) concentrations.
17569884 2007 A polymorphism in the protease-like domain of apolipoprotein(a) is associated with severe coronary artery disease.
17537433 2007 Galectin-1, an endogenous lectin produced by arterial cells, binds lipoprotein(a) [Lp(a)] in situ: relevance to atherogenesis.
17478739 2007 Lipoprotein (a) and stroke: a meta-analysis of observational studies.
17462619 2007 Variability in apo(a) gene regulatory sequences, compound genotypes, and association with Lp(a) plasma levels.
17460176 2007 Comparison of Lipoprotein(a) levels between elderly and middle-aged men with coronary artery disease.
17145597 2006 Lipoprotein(a), fibrinogen and vascular mortality in an elderly northern Italian population.
16893192 2006 Catalysis of covalent Lp(a) assembly: evidence for an extracellular enzyme activity that enhances disulfide bond formation.
16840570 2006 Three single-nucleotide polymorphisms in LPA account for most of the increase in lipoprotein(a) level elevation in African Americans compared with European Americans.
16625232 Diagnostic value of nitric oxide, lipoprotein(a), and malondialdehyde levels in the peripheral venous and cavernous blood of diabetics with erectile dysfunction.
16497311 2007 Elevated Lipoprotein(a) does not promote early atherosclerotic changes of the carotid arteries in young, healthy adults.
16403785 2006 Lipoprotein(a) in atherosclerotic plaques recruits inflammatory cells through interaction with Mac-1 integrin.
16202171 2005 Activity of peroxisomal enzymes, and levels of polyamines in LPA-transgenic mice on two different diets.
16197951 2006 Serum lipoprotein(a) levels and apolipoprotein(a) isoform size and risk for first-ever acute ischaemic nonembolic stroke in elderly individuals.
16150826 2005 Elements in the C terminus of apolipoprotein [a] responsible for the binding to the tenth type III module of human fibronectin.
16122830 2006 Serum lipoprotein (a) levels in patients with diabetic foot lesions.
16113787 2005 Mechanism for the homocysteine-enhanced antifibrinolytic potential of lipoprotein(a) in human plasma.
16053196 2005 Apolipoprotein(a) gene polymorphisms (TTTTA)n and G/A-914 affect Lp(a) levels in ischemic heart disease patients from Serbia.
15983325 2005 Prospective study of lipoprotein(a) as a risk factor for deteriorating renal function in type 2 diabetic patients with overt proteinuria.
15905467 2005 An apolipoprotein(a) peptide delays chylomicron remnant clearance and increases plasma remnant lipoproteins and atherosclerosis in vivo.
15708348 2005 The apolipoprotein(a) component of lipoprotein(a) mediates binding to laminin: contribution to selective retention of lipoprotein(a) in atherosclerotic lesions.
15654123 2005 High-level lipoprotein [a] expression in transgenic mice: evidence for oxidized phospholipids in lipoprotein [a] but not in low density lipoproteins.
15543335 2004 Neutrophils stimulated by apolipoprotein(a) generate fragments that are stronger inhibitors of plasmin formation than apo(a).
15523644 2004 A common nonsense mutation in the repetitive Kringle IV-2 domain of human apolipoprotein(a) results in a truncated protein and low plasma Lp(a).
15515480 2004 Lipoprotein (a) in patients on hemodialysis.
15479125 2004 Gender differences in plasma levels of lipoprotein (a) in patients with angiographically proven coronary artery disease.
15258620 Lp(a) and apoE polymorphisms in young South African Indians with myocardial infarction.
15041277 2003 Apolipoprotein (a) mediates the lipoprotein (a)-induced biphasic shift in human platelet cyclic AMP.
14746139 2003 Molecular variation at functional genes and the history of human populations--data on candidate genes for cardiovascular risk in the Mediterranean.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12940514 2003 Circulating transforming growth factor-beta1, lipoprotein(a) and cellular adhesion molecules in angiographically assessed coronary artery disease.
12738397 Lipoprotein(a), apolipoprotein(a) polymorphism and restenosis after intracoronary stent placement in Type 2 diabetic patients.
12578871 2003 Association of polymorphisms of the apolipoprotein(a) gene with lipoprotein(a) levels and myocardial infarction.
12562843 2003 Apolipoprotein[a] secretion from hepatoma cells is regulated in a size-dependent manner by alterations in disulfide bond formation.
12482643 2003 Lipoprotein(a) level and lipids in type 2 diabetic patients and their normoglycemic first-degree relatives in type 2 diabetic pedigrees.
12359323 2002 Possible association between genetic variability at the apolipoprotein(a) locus and Alzheimer's disease in apolipoprotein E2 carriers.
12220441 2002 Apolipoprotein molecular variation in Moroccan Berbers: pentanucleotide (TTTTA)n repeat in the LPA gene and APOE-C1-C2 gene cluster.
12127051 2002 APO(a) variants and lipoprotein(a) in men with or without myocardial infarction.
12111551 2002 Direct interaction of the extracellular matrix protein DANCE with apolipoprotein(a) mediated by the kringle IV-type 2 domain.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
11999088 Lipoprotein (a) phenotypes in south Indian patients with coronary artery disease.
11947970 2002 Type of diabetes and waist-hip ratio are important determinants of serum lipoprotein (a) levels in diabetic patients.
11833851 2001 Relationship between lipoprotein(a) levels, oxidative stress, and blood pressure levels in patients with essential hypertension.
11816712 2001 The Kringle V-protease domain is a fibrinogen binding region within Apo(a).
11485023 2001 Polymorphisms in human apolipoprotein(a) kringle IV-10 and coronary artery disease: relationship to allele size, plasma lipoprotein(a) concentration, and lysine binding site activity.
11440434 2001 Genetic evaluation of lipoprotein(a) in intracranial aneurysm disease.
11332648 2001 Genetic effect of two APOA repeat polymorphisms (kringle 4 and pentanucleotide repeats) on plasma Lp(a) levels in American Samoans.
11294842 2001 Structural elucidation of the N- and O-glycans of human apolipoprotein(a): role of o-glycans in conferring protease resistance.
11285247 2001 Single nucleotide polymorphisms in exons of the apo(a) kringles IV types 6 to 10 domain affect Lp(a) plasma concentrations and have different patterns in Africans and Caucasians.
11126727 2000 Apolipoprotein A polymorphisms and plasma lipoprotein(a) concentrations in non-Hispanic Whites and Hispanics.
10980194 2000 Mapping of a minimal apolipoprotein(a) interaction motif conserved in fibrin(ogen) beta - and gamma -chains.
10672142 2000 LPA gene: interaction between the apolipoprotein(a) size ('kringle IV' repeat) polymorphism and a pentanucleotide repeat polymorphism influences Lp(a) lipoprotein level.
10484779 1999 Molecular basis of congenital lp(a) deficiency: a frequent apo(a) 'null' mutation in caucasians.
10187779 1999 Macrophage metalloelastase, MMP-12, cleaves human apolipoprotein(a) in the linker region between kringles IV-4 and IV-5. Potential relevance to lipoprotein(a) biology.
10073957 1999 Identification of megalin/gp330 as a receptor for lipoprotein(a) in vitro.
9717723 1998 Inhibition of N-linked glycosylation results in retention of intracellular apo[a] in hepatoma cells, although nonglycosylated and immature forms of apolipoprotein[a] are competent to associate with apolipoprotein B-100 in vitro.
9548923 1998 Intracellular metabolism of human apolipoprotein(a) in stably transfected Hep G2 cells.
9269765 1997 Novel interaction of apolipoprotein(a) with beta-2 glycoprotein I mediated by the kringle IV domain.
9111002 1997 Polymorphonuclear cells isolated from human peripheral blood cleave lipoprotein(a) and apolipoprotein(a) at multiple interkringle sites via the enzyme elastase. Generation of mini-Lp(a) particles and apo(a) fragments.
8864963 1996 Functional and metabolic differences between elastase-generated fragments of human lipoprotein[a] and apolipoprotein[a].
8642595 1996 Crystal structures of apolipoprotein(a) kringle IV37 free and complexed with 6-aminohexanoic acid and with p-aminomethylbenzoic acid: existence of novel and expected binding modes.
8047165 1994 Activation of transforming growth factor-beta is inhibited in transgenic apolipoprotein(a) mice.
7918682 1994 A single point mutation (Trp72-->Arg) in human apo(a) kringle 4-37 associated with a lysine binding defect in Lp(a).
7848387 1993 Amplification of human APO(a) kringle 4-37 from blood lymphocyte DNA.
7679504 1993 5' control regions of the apolipoprotein(a) gene and members of the related plasminogen gene family.
3670400 1987 cDNA sequence of human apolipoprotein(a) is homologous to plasminogen.
3410459 1988 The apolipoprotein(a) gene resides on human chromosome 6q26-27, in close proximity to the homologous gene for plasminogen.
2531657 1989 Lipoprotein(a) binds to fibronectin and has serine proteinase activity capable of cleaving it.
2530631 1989 The mysteries of lipoprotein(a).