Property Summary

NCBI Gene PubMed Count 121
PubMed Score 344.51
PubTator Score 225.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count
Exfoliation syndrome 8

Expression

Protein-protein Interaction (3)

Gene RIF (136)

PMID Text
26404116 Different SNPs in LOXL1 affect risk of pseudoexfoliative glaucoma in different ethnic groups [meta-analysis]
26348632 results indicate that hypermethylation of CpG islands in the promoter region of the LOXL1 gene leads directly to downregulation of LOXL1 mRNA and protein, which functions as an essential mechanism in the pathogenesis of Pseudoexfoliation Syndrome
26319397 Single nucleotide polymorphisms of the LOXL1 gene are associated with pseudoexfoliation glaucoma in the Spanish population.
26307087 To identify additional candidate functional variants, we sequenced the entire LOXL1 genomic locus ( approximately 40 kb) in 50 indigenous, black South African XFS cases and 50 matched controls.
25988230 Aortic tissue from Marfan syndrome patients and display enhanced expression of the members of the LOX family, LOX and LOX-like 1.
25750511 The polymorphisms of the LOXL1 gene were associated with the susceptibility to primary open-angle glaucoma.
25636109 There were no significant difference in allele frequency distribution of LOXL1 rs1048661rs3825942 and rs2165241 between primary open-angle glaucoma (POAG) and normal controls (P=0.322, P=0.660, P=0.965).
25304275 Our meta-analysis indicates that rs1048661 had weak association with XFG/XFS; rs3825942 had strongly association with XFG/XFS; and rs2165241 had significant risk with XFG/XFS in some ethnicity.
25275910 Collectively, these results suggest that dysregulation of LOXL1 expression is a contributing factor to exfoliation disease development.
25275906 Pathogenetic stimuli induced a significant increase in the expression of LOXL1 and elastic proteins and resulted in their assembly into exfoliation syndrome-like fibrils in vitro.
25130441 When the LOXL1 variants were used as disease markers for clinically undetectable exfoliation syndrome (EX), there was no association between central retinal vein occlusion and EX.
25118846 p66beta might be important for the regulation of LOX in the nucleus.
25041436 Our results demonstrate that only a small proportion of individuals with the high-risk GG/GG diplotype may actually be found to clinically manifest exfoliation syndrome.
25017124 Human LOX gene encodes 2 variants, LOX and LOX-v2, both of which function as amine oxidases with distinct tissue specificities.
24938310 Data indicate that single-nucleotide polymorphisms (SNPs) distributing in not only lysyl oxidase-like 1 gene (LOXL1) but also TBC1 domain family member 21 protein (TBC1D21) and promyelocytic leukemia protein (PML).
24917141 LOXL1 gene contributes to onset of PEXG through PEX. Gene variants of LOXL1 do not help to identify those with PEX at increased risk for glaucoma development.
24893574 This polymorphism seems to be associated with high risk for primary open-angle glaucoma in a Mediterranean population.
24892565 This is the first study associating two SNPs of LOXL1 (rs3825942 and rs2165241) and XFS/XFG in a Spanish population, confirming findings in patients from Europe.
24809751 Sequencing of 7 exons and regulatory regions of LOXL1 identified 11 additional sequence variants; only rs41435250 showed an association (P = 3.80 x 10-5 [0.49]) with pseudoexfoliation syndrome and glaucoma
24739284 Haplotypes of LOXL1 are associated with PG-PDS independently from rs1048661, leading to a differential expression of the transcript.
24614111 CTR1, ATP7A, and lysyl oxidase were upregulated in the lung tissues and pulmonary arteries of mice with hypoxia-induced pulmonary hypertension and pulmonary arterial smooth muscle cells.
24603551 Studies suggest that LOXL1 rs1048661 TT, rs3825942 AA, and rs2165241 CC were associated with a reduced risk of developing pseudoexfoliation syndrome and pseudoexfoliation glaucoma (PEXS/PEXG).
24068861 allele T of LOXL1 rs41435250 is a novel risk genetic factor for pseudoexfoliation syndrome/pseudoexfoliation glaucoma development.
23886154 High Lysyl Oxidase expression is associated with non-small cell lung cancer.
23869164 Certain genetic variants in LOXL1 confer risk for pseudoexfoliation syndrome in Greek populations.
23687437 Association of LOXL1 with exfoliation syndrome and exfoliation glaucoma was investigated and apolipoprotein E and MTHFR polymorphisms as genetic risk factors for both conditions, were evaluated.
23494965 Data suggest that all members of LOX gene family (lysyl-oxidase [LOX]; lysyl oxidase-like proteins [LOXL1, LOXL2, LOXL3]) are over-expressed in bone marrow in primary myelofibrosis; LOX gene family is not detectable in normal bone marrow.
23441117 Three SNPs of LOXL1 (rs1048661, rs3825942, and 2,165,241) are highly associated with pseudoexfoliation syndrome in a Korean population.
23411028 LOXL1 is more abundant in the deposits in the iris region and, alternatively APOE is concentrated in the PEX material accumulated in the pupillary area of the anterior lens capsule.
23378724 None of the patients with exfoliation syndrome/glaucoma has the adenine (A) allele single nucleotide polymorphism (SNP) of rs3825942, whereas 16% of the control subjects have the LOXL1 variant.
23357697 TGF-beta1 induced injured MCL to express more LOXs than injured ACL (up to 1.85-fold in LOX, 2.21-fold in LOXL-1, 1.71-fold in LOXL-2, 2.52-fold in LOXL-3 and 3.32-fold in LOXL-4).
23288989 There was no significant difference in the frequency of the DNA copy number variants in the LOXL1 region between the exfoliation glaucoma cases and the controls.
23196386 Knockdown of E2F1 stabilized HIF-1alpha and promoted LOX expression, while knockdown of both E2F1 and HIF-1alpha prevented the up-regulation of LOX
22911823 The -22G/C polymorphism may affect the expression of LOX, and that -22G/C and 473G/A polymorphisms may be new risk factors for osteosarcoma.
22906264 study suggests that LOX G473A polymorphism is a new risk factor for ovarian cancer and that LOX protein might be a possible therapeutic target in ovarian cancer
22765198 The homozygote TT polymorphism in the rs1048661 and rs2165241 region of LOX-L1 gene may be responsible for stress urinary incontinance physiopathology.
22633114 The findings provide evidence for a pseudoexfoliation-specific elastinopathy of the lamina cribrosa resulting from a primary disturbance in LOXL1 regulation and elastic fiber homeostasis.
22605916 A significant association was found for the G allele of rs1048661 and rs3825942 in pseudoexfoliative glaucoma patients of Pakistani origin.
22487196 Data suggest that expression of LOXL1 and FBLN5 (fibulin 5) (but not expression of elastin) is down-regulated in uterosacral ligaments of postmenopausal women with pelvic organ prolapse.
22328822 The R141L and G153D variations in the NH2-terminal region of LOXL1 do not affect the amine oxidase activity of LOXL1 associated with exfoliation glaucoma.
22194657 LOXL1 variants, well established markers for exfoliation syndrome, are not likely genetic markers for branch retinal vein occlusion in Japanese subjects.
22128228 Three LOXL1 single nucleotide polymorphisms are associated with exfoliation syndrome in the Korean population.
21970694 This is the first study associating LOXL1 gene polymorphism and pseudoexfoliation syndrome (XFS) is a major risk factor for exfoliation glaucoma in Latin America.
21948647 The findings support the notion that both genetic and nongenetic fibrogenic factors, particularly TGF-beta1 and oxidative stress, may cooperate in the stable accumulation of PEX (pseudoexfoliation syndrome) aggregates.
21855673 Our results of a negative association between variants of the LOXL1 gene and exudative AMD suggest that the involvement of rs1048661 in the LOXL1 gene as a risk allele for exudative AMD might be small if present.
21784201 Our results suggest that rs1048661 in LOXL1 is not implicated in the development of AMD in the Italian population in spite of a very good statistical power to replicate the reported strong associations.
21740577 The human lysyl oxidase-like 1 gene does not confer increased genotypic risk for adolescent idiopathic scoliosis.
21738402 LOXL1 is a susceptibility gene of exfoliation syndrome/exfoliation glaucoma (XFS/XFG) in Uygur populations of China.
21674292 Transforming Growth Factor-Beta induces up-regulation expression of lysyl oxidase family in anterior cruciate ligament and medial collateral ligament fibroblasts.
21559813 LOXL1 is not found to be a gene with major risk for Alzheimer's disease.
21510775 The Saudi Arabian primary open angle glaucoma (POAG) population, similar to all other populations studied to date, demonstrates no association with SNPs associated with pseudoexfoliation glaucoma.
21320968 The LOXL1 SNPs R141L and G153D are significantly associated with exfoliation syndrome in this black South African population.
21272281 Single nucleotide polymorphisms in LOXL1 are associated with pseudoexfoliation syndrome in Polish population which confirms the association previously reported for Icelandic, Swedish, Indian and other populations.
21236409 These findings suggest that there is a significant association between the ARMS2 gene and LOXL1 gene in exudative age-related macular degeneration.
21212179 LOXL1 promoter haplotypes were identified that are significantly associated with exfoliation syndrome and exfoliation glaucoma in a U.S. Caucasian population.
21197115 The "G" allele of both rs1048661 and rs3825942 single nucleotide polymorphisms were associated with the risk of pseudoexfoliation glaucoma in the Saudi Arab population.
21190048 Spectroscopic results show that in all cases lysyl oxidase folds correctly but that the copper content, enzymatic activity, and redox-cycling ability depends on the mutation.
21139690 These results establish that LOXL1 expression is reduced in lens capsule specimens from pseudoexfoliation glaucoma individuals but not pseudoexfoliation syndrome.
20940247 gene expression profiles of peritoneal and ovarian endometriotic lesions compared to endometrial tissue of nonaffected women; different expression found for HTRA1 and LOXL1, upregulated in ectopic endometrium, suggesting involvement in endometriosis
20613779 besides changes caused by the fibulin-5 mutation, LOXL1 gene regulation is affected by an epigenetic mechanism that can be reversed by an inhibitor of DNA methyltransferase activity
20436359 These results suggest that the G allele in these SNPs has no direct role in the development of vascular diseases associated with exfoliation syndrome (XFS) and exfoliative glaucoma (XFG)
20436359 Observational study of gene-disease association. (HuGE Navigator)
20431720 G allele of major susceptibility variant rs3825942 increases risk of exfoliation glaucoma(XFG); strong association with opposite allele in South African population. Unknown causal variants of LOXL1 contribute to genetic risk of XFG.
20431720 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20142848 LOXL1 is not associated with primary open angle glaucoma in all study populations.
20051886 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19936304 LOXL1 is a susceptibility gene of exfoliation syndrome/exfoliation glaucoma in the Chinese population, and the association is mainly attributed to single nucleotide polymorphisms rs1048661.
19936304 Observational study of gene-disease association. (HuGE Navigator)
19763368 no consistent pattern among sites in the vagina in pelvic organ prolapse
19724858 Expression of LOXL, LOXL2, LOXL3 and LOXL4 was not statistically associated with tumor location, stage, growth type, or differentiation status in colorectal adenocarcinomas
19664108 Lysyl oxidase like 1 (LOXL1) on chromosome 15q24 is a major gene for exfoliation syndrome and exfoliation glaucoma. (Review)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19503743 Polymorphisms in LOXL1 confer risk to pseudoexfoliation syndrome (XFS) / pseudoexfoliation glaucoma (XFG) in the Chinese; the G allele of rs3825942 has been shown to be associated with XFS/XFG in all populations studied to date
19503743 Observational study of gene-disease association. (HuGE Navigator)
19450918 There was decreased expression of fibulin-5 and increased expression of lysyl oxidase-like 1 in uterosacral ligaments in patients with pelvic organ prolapse, which suggests the possibility of defects in elastin synthesis.
19373106 Our study reveals that in the German population the LOXL1 genetic predisposition is limited to exfoliation glaucoma and does not include normal tension glaucoma.
19373106 Observational study of gene-disease association. (HuGE Navigator)
19343041 The earlier reported polymorphisms of the LOXL1 gene showed significant association also in the Finnish population.
19343041 Observational study of gene-disease association. (HuGE Navigator)
19240540 Pseudoexfoliation syndrome (XFS) is an important risk factor for glaucoma and lysyl oxidase-like 1 polymorphisms are strongly associated with XFS. (Review)
19182211 A functional single nucleotide polymorphism exists in the promoter region of the LOXL1 gene that does not contribute significantly to risk of pelvic organ prolapse or preterm premature rupture of membranes.
19182211 Observational study of gene-disease association. (HuGE Navigator)
19112534 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19098994 Individual LOXL1 single nucleotide polymorphisms, rs1048661, rs3825942, and rs2165241, were not associated with primary open-angle glaucoma in the Chinese population.
19098994 Observational study of gene-disease association. (HuGE Navigator)
18974306 Results provide evidence for lysyl oxidase-like 1 involvement in the initial stages of abnormal fibrogenesis in pseudoexfoliation syndrome tissues.
18958304 The association of lysyl oxidase like 1 (LOXL1) gene variants in Japanese patients with open-angle glaucoma, was evaluated.
18958304 Observational study of gene-disease association. (HuGE Navigator)
18806885 Observational study of gene-disease association. (HuGE Navigator)
18648524 Single nucleotide polymorphisms of LOXL1 (rs1048661; Arg141Leu and rs3825942; Gly153Asp) are highly associated with exfoliation syndrome in the Japanese population.
18636115 LOXL1 polymorphisms were associated with exfoliation syndrome. These polymorphisms had no influence on the phenotypic features of primary open-angle glaucoma patients.
18636115 Observational study of gene-disease association. (HuGE Navigator)
18618003 There was no involvement of the LOXL1 single nucleotide polymorphisms in patients with pigment dispersion syndrome and pigmentary glaucoma.
18618003 Observational study of gene-disease association. (HuGE Navigator)
18552979 Genetic association studies were performed using a native Japanese population to examine the reproducibility of results of lysyl oxidase-like 1 (LOXL1) genetic association studies for exfoliation glaucoma (XFG) beyond the differences of ethnicity.
18552979 Observational study of gene-disease association. (HuGE Navigator)
18541854 Two mutations in lysyl oxidase-like 1 gene confer susceptibility to exfoliative glaucoma, primarily through exfoliation syndrome(XFS). Can we modulate LOXL1 activity to alter the course of XFS? (Review)
18483563 These data confirm the previously reported association between LOXL1 polymorphisms and XFG and extend our knowledge to a Central European population.
18483563 Observational study of gene-disease association. (HuGE Navigator)
18450598 Polymorphisms in the LOXL1 gene confer risk of pseudoexfoliation glaucoma and pseudoexfoliation glaucoma in Japanese, but with different risk-associated alleles and haplotypes.
18450598 Observational study of gene-disease association. (HuGE Navigator)
18421074 There was no association between SNPs in the LOXL1 gene and POAG. This is the first analysis of the LOXL1 gene in African-American and West-African populations.
18421074 Observational study of gene-disease association. (HuGE Navigator)
18385788 LOXL1 SNPs are located in 15q24.1 band and within genetic locus (GLC1N) associated with primary open-angle glaucoma (POAG). LOXL1 genetic predisposition is only limited to exfoliation with or without glaucoma and does not include POAG phenotype.
18385788 Observational study of gene-disease association. (HuGE Navigator)
18385063 Genetic variants in LOXL1 confer risk to PEX in German and Italian populations, independent of the presence of secondary glaucoma, confirming findings in patients from Northern Europe.
18385063 Observational study of gene-disease association. (HuGE Navigator)
18334947 Out of the two non-synonymous single nucleotide polymorphisms in exon 1 of the LOXL1 gene, rs3825942 has a significant association with pseudoexfoliation syndrome cases in the patients of the southern Indian population.
18334947 Observational study of gene-disease association. (HuGE Navigator)
18334928 An analysis of LOXL1 and pseudoexfoliation glaucoma in a United States patient population was performed and confirmed the strong association previously reported for Icelandic and Swedish samples.
18334928 Observational study of gene-disease association. (HuGE Navigator)
18332326 LOXL1 DNA sequence variants are associated with pseudoexfoliation will encourage new investigations into the role of elastin.
18287813 Our findings confirm genetic association of LOXL1 with Exfoliation glaucoma (XFG) and exfoliation syndrome and implicate a potential role of cross linking of elastin in the pathogenesis of XFG.
18287813 Observational study of gene-disease association. (HuGE Navigator)
18282488 Two single-nucleotide polymorphism in the LOXL1 gene seem to be associated with exfoliation syndrome in the Japanese population
18254956 G153D LOXL1 variant is significantly associated with an increased risk of pseudoexfoliation and pseudoexfoliation glaucoma in an ethnically diverse patient population from the Northeastern United States
18254956 Observational study of gene-disease association. (HuGE Navigator)
18223248 The results from the present study do not indicate the involvement of the LOXL1 SNPs in primary open-angle and primary angle-closure glaucomas.
18223248 Observational study of gene-disease association. (HuGE Navigator)
18201684 LOXL1 single-nucleotide polymorphism variants are associated with pseudoexfoliation, but with a much lower prevalence of the G allele of rs1048661 in the Japanese population.
18201684 The SNPs rs1048661 and rs3825942 of the LOXL1 gene seem to be highly associated with XFS in the Japanese population, but a different polymorphism of LOXL1 may cause the development of XFS in the Japanese population.
18201684 Observational study of gene-disease association. (HuGE Navigator)
18037624 Ancestral LOXL1 variants are associated with pseudoexfoliation in Caucasian Australians but with markedly lesser penetrance than in Nordic people.
18037624 Observational study of gene-disease association. (HuGE Navigator)
18036875 These results confirm the previously detected association between LOXL1 and exfoliation syndrome.
17999374 Levels of LOXL1 diminish with aging and were significantly decreased in the varicose condition.
17891191 Polymorphisms in the coding region of the LOXL1 gene located on chronosome 15q24 are associated with PXS and PEXG in population.
17690546 Observational study of gene-disease association. (HuGE Navigator)
17690546 Genetic variation in LOXL1 might play a role as a risk factor for spontaneous cervical artery dissection.
17690259 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17690259 The product of LOXL1 catalyzes the formation of elastin fibers found to be a major component of the lesions in exfoliation glaucoma
17287949 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16842595 dill extract induces the LOXL gene expression in adult skin
16251195 pro-regions of lysyl oxidase and lysyl oxidase-like 1 are required for deposition onto elastic fibers
12577300 comparison and aa sequence alignment of human and rat lysyl oxidase and human LOXL1

AA Sequence

MALARGSRQLGALVWGACLCVLVHGQQAQPGQGSDPARWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSE      1 - 70
SSSRVLLAGAPQAQQRRSHGSPRRRQAPSLPLPGRVGSDTVRGQARHPFGFGQVPDNWREVAVGDSTGMA     71 - 140
RARTSVSQQRHGGSASSVSASAFASTYRQQPSYPQQFPYPQAPFVSQYENYDPASRTYDQGFVYYRPAGG    141 - 210
GVGAGAAAVASAGVIYPYQPRARYEEYGGGEELPEYPPQGFYPAPERPYVPPPPPPPDGLDRRYSHSLYS    211 - 280
EGTPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQ    281 - 350
QGRLSVGSVYRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAPEATDYDVRVLL    351 - 420
RFPQRVKNQGTADFLPNRPRHTWEWHSCHQHYHSMDEFSHYDLLDAATGKKVAEGHKASFCLEDSTCDFG    421 - 490
NLKRYACTSHTQGLSPGCYDTYNADIDCQWIDITDVQPGNYILKVHVNPKYIVLESDFTNNVVRCNIHYT    491 - 560
GRYVSATNCKIVQS                                                            561 - 574
//

Text Mined References (124)

PMID Year Title
26404116 2015 Ethnicity-Based Differences in the Association of LOXL1 Polymorphisms with Pseudoexfoliation/Pseudoexfoliative Glaucoma: A Meta-Analysis.
26348632 2015 LOXL1 Hypermethylation in Pseudoexfoliation Syndrome in the Uighur Population.
26319397 2015 LOXL1 gene variants and their association with pseudoexfoliation glaucoma (XFG) in Spanish patients.
26307087 2015 Genetic variants and cellular stressors associated with exfoliation syndrome modulate promoter activity of a lncRNA within the LOXL1 locus.
25988230 2015 Elevated expression levels of lysyl oxidases protect against aortic aneurysm progression in Marfan syndrome.
25750511 2015 Associations of polymorphisms of LOXL1 gene with primary open-angle glaucoma: a meta-analysis based on 5,293 subjects.
25636109 2015 [Association between LOXL1 gene polymorphisms and primary open angle glaucoma in Sichuan population].
25304275 2016 LOXL1 Gene Polymorphism With Exfoliation Syndrome/Exfoliation Glaucoma: A Meta-Analysis.
25275910 Expression and regulation of LOXL1 and elastin-related genes in eyes with exfoliation syndrome.
25275906 Expression and regulation of LOXL1 and elastin-related genes in eyes with exfoliation syndrome.
25130441 2015 Lack of association of LOXL1 gene variants in Japanese patients with central retinal vein occlusion without clinically detectable pseudoexfoliation material deposits.
25118846 2014 Nuclear translocation of lysyl oxidase is promoted by interaction with transcription repressor p66?.
25041436 2015 Screening phenotypically normal Caucasian Australians for the lysyl oxidase-like 1 gene.
25017124 2014 Alternative promoter activation leads to the expression of a novel human lysyl oxidase variant that functions as an amine oxidase.
24938310 2014 Novel common variants and susceptible haplotype for exfoliation glaucoma specific to Asian population.
24917141 2014 Association of LOXL1 polymorphisms with pseudoexfoliation, glaucoma, intraocular pressure, and systemic diseases in a Greek population. The Thessaloniki eye study.
24893574 Genetic polymorphism related to exfoliative glaucoma is also associated with primary open-angle glaucoma risk.
24892565 2016 Association of Lysyl Oxidase-Like 1 Gene Polymorphisms in Pseudoexfoliation Syndrome and Pseudoexfoliation Glaucoma in a Spanish Population.
24809751 2014 Lysyl oxidase-like 1 gene in the reversal of promoter risk allele in pseudoexfoliation syndrome.
24739284 2014 Common sequence variants in the LOXL1 gene in pigment dispersion syndrome and pigmentary glaucoma.
24614111 2014 Upregulated copper transporters in hypoxia-induced pulmonary hypertension.
24603551 2014 Association between polymorphisms in lysyl oxidase-like 1 and susceptibility to pseudoexfoliation syndrome and pseudoexfoliation glaucoma.
24068861 2013 The T allele of lysyl oxidase-like 1 rs41435250 is a novel risk factor for pseudoexfoliation syndrome and pseudoexfoliation glaucoma independently and through intragenic epistatic interaction.
23886154 2013 Expression and significance of hypoxia inducible factor-1? and lysyl oxidase in non-small cell lung cancer.
23869164 2013 Association of lysyl oxidase-like 1 gene common sequence variants in Greek patients with pseudoexfoliation syndrome and pseudoexfoliation glaucoma.
23687437 2013 Development of novel LOXL1 genotyping method and evaluation of LOXL1, APOE and MTHFR polymorphisms in exfoliation syndrome/glaucoma in a Greek population.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23494965 2013 The expression of lysyl-oxidase gene family members in myeloproliferative neoplasms.
23441117 2013 Evaluation of lysyl oxidase-like 1 gene polymorphisms in pseudoexfoliation syndrome in a Korean population.
23411028 2013 MALDI MS imaging analysis of apolipoprotein E and lysyl oxidase-like 1 in human lens capsules affected by pseudoexfoliation syndrome.
23378724 2013 Association of LOXL1 gene polymorphisms with exfoliation syndrome/glaucoma and primary open angle glaucoma in a Turkish population.
23357697 2013 TGF-beta1 induces the different expressions of lysyl oxidases and matrix metalloproteinases in anterior cruciate ligament and medial collateral ligament fibroblasts after mechanical injury.
23288989 2012 The role of lysyl oxidase-like 1 DNA copy number variants in exfoliation glaucoma.
23196386 2013 Lysyl oxidase is induced by cell density-mediated cell cycle suppression via RB-E2F1-HIF-1? axis.
22911823 2012 Lysyl oxidase polymorphisms and susceptibility to osteosarcoma.
22906264 2012 Association between lysyl oxidase G473A polymorphism and ovarian cancer in the Han Chinese population.
22765198 2013 TT polymorphism in rs2165241 and rs1048661 region in lysyl oxidase like-1 gene may have a role in stress urinary incontinence physiopathology.
22633114 2012 LOXL1 deficiency in the lamina cribrosa as candidate susceptibility factor for a pseudoexfoliation-specific risk of glaucoma.
22605916 2012 Role of Lysyl oxidase-like 1 gene polymorphisms in Pakistani patients with pseudoexfoliative glaucoma.
22487196 2012 Decreased expression of elastin, fibulin-5 and lysyl oxidase-like 1 in the uterosacral ligaments of postmenopausal women with pelvic organ prolapse.
22328822 2012 Variations in LOXL1 associated with exfoliation glaucoma do not affect amine oxidase activity.
22194657 2011 Analysis of LOXL1 gene variants in Japanese patients with branch retinal vein occlusion.
22128228 2011 Association of lysyl oxidase-like 1 gene polymorphisms with exfoliation syndrome in Koreans.
21970694 2012 Prevalence of high-risk alleles in the LOXL1 gene and its association with pseudoexfoliation syndrome and exfoliation glaucoma in a Latin American population.
21948647 2011 Regulation of lysyl oxidase-like 1 (LOXL1) and elastin-related genes by pathogenic factors associated with pseudoexfoliation syndrome.
21855673 2011 Polymorphisms in ARMS2 (LOC387715) and LOXL1 genes in the Japanese with age-related macular degeneration.
21784201 2011 Polymorphisms in ARMS2 (LOC387715) and LOXL1 genes in the Japanese with age-related macular degeneration.
21740577 2011 Common polymorphisms in human lysyl oxidase genes are not associated with the adolescent idiopathic scoliosis phenotype.
21738402 2011 Evaluation of LOXL1 polymorphisms in exfoliation syndrome in the Uygur population.
21674292 2012 Up-regulation expressions of lysyl oxidase family in Anterior Cruciate Ligament and Medial Collateral Ligament fibroblasts induced by Transforming Growth Factor-Beta 1.
21559813 2011 No association of LOXL1 gene polymorphisms with Alzheimer's disease.
21510775 2012 Lack of association between LOXL1 gene polymorphisms and primary open angle glaucoma in the Saudi Arabian population.
21320968 2011 An investigation into LOXL1 variants in black South African individuals with exfoliation syndrome.
21272281 2011 Analysis of LOXL1 single nucleotide polymorphisms in Polish population with pseudoexfoliation syndrome.
21236409 2011 Polymorphisms in ARMS2 (LOC387715) and LOXL1 genes in the Japanese with age-related macular degeneration.
21212179 2011 LOXL1 promoter haplotypes are associated with exfoliation syndrome in a U.S. Caucasian population.
21197115 2010 Analysis of LOXL1 polymorphisms in a Saudi Arabian population with pseudoexfoliation glaucoma.
21190048 2011 Identification of the copper-binding ligands of lysyl oxidase.
21139690 2010 LOXL1 expression in lens capsule tissue specimens from individuals with pseudoexfoliation syndrome and glaucoma.
20940247 2010 Deregulation of LOXL1 and HTRA1 gene expression in endometriosis.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20613779 2010 Epigenetic silencing of lysyl oxidase-like-1 through DNA hypermethylation in an autosomal recessive cutis laxa case.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20436359 2011 LOXL1 gene sequence variants and vascular disease in exfoliation syndrome and exfoliative glaucoma.
20431720 2010 Major LOXL1 risk allele is reversed in exfoliation glaucoma in a black South African population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20142848 2010 Ethnicity-based subgroup meta-analysis of the association of LOXL1 polymorphisms with glaucoma.
20051886 2010 Lack of association of polymorphisms in elastin with pseudoexfoliation syndrome and glaucoma.
19936304 2009 Evaluation of LOXL1 polymorphisms in exfoliation syndrome in a Chinese population.
19763368 2009 Is lysyl oxidase-like protein-1, alpha-1 antitrypsin, and neutrophil elastase site specific in pelvic organ prolapse?
19724858 2009 Differential expression of the LOX family genes in human colorectal adenocarcinomas.
19664108 2009 From epidemiology to lysyl oxidase like one (LOXL1) polymorphisms discovery: phenotyping and genotyping exfoliation syndrome and exfoliation glaucoma in Iceland.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19503743 2009 Association of LOXL1 polymorphisms with pseudoexfoliation in the Chinese.
19450918 2009 Changes in expression of fibulin-5 and lysyl oxidase-like 1 associated with pelvic organ prolapse.
19373106 2010 Lysyl oxidase-like 1 gene polymorphisms in German patients with normal tension glaucoma, pigmentary glaucoma and exfoliation glaucoma.
19343041 2009 Association of LOXL1 gene with Finnish exfoliation syndrome patients.
19240540 2009 Genetics of pseudoexfoliation syndrome.
19182211 2009 A single nucleotide polymorphism in the promoter of the LOXL1 gene and its relationship to pelvic organ prolapse and preterm premature rupture of membranes.
19112534 2008 Lack of association of polymorphisms in homocysteine metabolism genes with pseudoexfoliation syndrome and glaucoma.
19098994 2008 Evaluation of LOXL1 polymorphisms in primary open-angle glaucoma in southern and northern Chinese.
18974306 2008 Genotype-correlated expression of lysyl oxidase-like 1 in ocular tissues of patients with pseudoexfoliation syndrome/glaucoma and normal patients.
18958304 2008 LOXL1 variants in elderly Japanese patients with exfoliation syndrome/glaucoma, primary open-angle glaucoma, normal tension glaucoma, and cataract.
18806885 2008 Genetic analysis of the clusterin gene in pseudoexfoliation syndrome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18648524 2008 Evaluation of LOXL1 polymorphisms in eyes with exfoliation glaucoma in Japanese.
18636115 2008 Lysyl oxidase-like 1 gene polymorphisms in Japanese patients with primary open angle glaucoma and exfoliation syndrome.
18618003 2008 Exfoliation syndrome and exfoliation glaucoma-associated LOXL1 variations are not involved in pigment dispersion syndrome and pigmentary glaucoma.
18552979 2008 LOXL1 genetic polymorphisms are associated with exfoliation glaucoma in the Japanese population.
18541854 2008 Exfoliation syndrome: beyond glaucoma.
18483563 2008 Lysyl oxidase-like protein 1 (LOXL1) gene polymorphisms and exfoliation glaucoma in a Central European population.
18450598 2008 Association of LOXL1 gene polymorphisms with pseudoexfoliation in the Japanese.
18421074 2008 Lack of association between LOXL1 variants and primary open-angle glaucoma in three different populations.
18385788 2008 Evaluation of LOXL1 gene polymorphisms in exfoliation syndrome and exfoliation glaucoma.
18385063 2008 Association of LOXL1 common sequence variants in German and Italian patients with pseudoexfoliation syndrome and pseudoexfoliation glaucoma.
18334947 2008 Association of non-synonymous single nucleotide polymorphisms in the LOXL1 gene with pseudoexfoliation syndrome in India.
18334928 2008 Analysis of LOXL1 polymorphisms in a United States population with pseudoexfoliation glaucoma.
18332326 2008 Association Between LOXL1 and pseudoexfoliation.
18287813 2008 Genetic association of LOXL1 gene variants and exfoliation glaucoma in a Utah cohort.
18282488 2008 The use of microarray technology in deciphering the cause of genetic eye diseases: LOXL1 and exfoliation syndrome.
18254956 2008 DNA sequence variants in the LOXL1 gene are associated with pseudoexfoliation glaucoma in a U.S. clinic-based population with broad ethnic diversity.
18223248 2008 The LOXL1 gene variations are not associated with primary open-angle and primary angle-closure glaucomas.
18201684 2008 Lysyl oxidase-like 1 polymorphisms and exfoliation syndrome in the Japanese population.
18037624 2008 Ancestral LOXL1 variants are associated with pseudoexfoliation in Caucasian Australians but with markedly lower penetrance than in Nordic people.
18036875 2007 LOXL1 mutations are associated with exfoliation syndrome in patients from the midwestern United States.
17999374 2008 Down-regulation of lysyl oxydase-like in aging and venous insufficiency.
17891191 2007 Progress in understanding pseudoexfoliation syndrome and pseudoexfoliation-associated glaucoma.
17690546 2007 Association between single nucleotide polymorphisms in the lysyl oxidase-like 1 gene and spontaneous cervical artery dissection.
17690259 2007 Common sequence variants in the LOXL1 gene confer susceptibility to exfoliation glaucoma.
17287949 2007 Systematic screening of lysyl oxidase-like (LOXL) family genes demonstrates that LOXL2 is a susceptibility gene to intracranial aneurysms.
16842595 2006 LOXL as a target to increase the elastin content in adult skin: a dill extract induces the LOXL gene expression.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16251195 2005 The Pro-regions of lysyl oxidase and lysyl oxidase-like 1 are required for deposition onto elastic fibers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15086544 2004 Lysyl oxidase-like and lysyl oxidase are present in the dermis and epidermis of a skin equivalent and in human skin and are associated to elastic fibers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14550642 2003 Purification of enzymatically active human lysyl oxidase and lysyl oxidase-like protein from Escherichia coli inclusion bodies.
12686136 2003 Structural and functional diversity of lysyl oxidase and the LOX-like proteins.
12577300 2003 Lysyl oxidase: properties, specificity, and biological roles inside and outside of the cell.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11642359 2001 Lysyl oxidases: a novel multifunctional amine oxidase family.
10773658 2000 Physical linkage of the lysyl oxidase-like (LOXL1) gene to the PML gene on human chromosome 15q22.
7706256 1995 A new gene with sequence and structural similarity to the gene encoding human lysyl oxidase.
7689553 1993 A novel human cDNA with a predicted protein similar to lysyl oxidase maps to chromosome 15q24-q25.