Property Summary

NCBI Gene PubMed Count 150
PubMed Score 2062.95
PubTator Score 523.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Aortic aneurysm 34 0.0 4.0

Expression

  Differential Expression (25)

Protein-protein Interaction (2)

Gene RIF (123)

PMID Text
26908052 Results show that LOX expression regulation by FoxF1 increases invasiveness of breast cancer cells.
26893379 The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites.
26838787 Individuals with LOX variants had fusiform enlargement of the aortic root and ascending thoracic aorta, leading to ascending aortic dissections.
26713757 two LOX variants, rs2956540 and rs10519694, may affect individual susceptibility to keratoconus
26515140 LOX expression at the mRNA and protein level, and enzymatic activity were remarkably upregulated in the hypoxic A549 cells, compared with normoxic A549 cells.
26437801 Cu chaperone function of Atox1 mediated through Cu transporter ATP7A is required for VEGF-induced angiogenesis via activation of Cu enzyme lysyl oxidase.
26085300 hypoxic stress of obstructive sleep apnea may increase circulating lysyl oxidase (LOX) levels; LOX may serve as a biomarker of liver fibrosis in patients with severe obesity and nonalcoholic fatty liver disease
26077591 Using principal component analysis (PCA), the authors identified a LOX/hypoxia signature associated with poor patient survival in resectable pancreatic ductal adenocarcinoma patients.
26048020 LOX gene expression is a predictive factor in hepatocellular liver cancer prognosis and mortality.
26017313 LOX is a novel regulator of NFATc1-driven osteoclastogenesis, independent of RANK ligand, which disrupts normal bone homeostasis leading to the formation of focal pre-metastatic lesions
26011922 LOX gene expression was approximately 2.5-fold higher in fetal membranes from preterm prelabor rupture of membranes (pPROM) compared to preterm and term birth.
25988230 Aortic tissue from Marfan syndrome patients and display enhanced expression of the members of the LOX family, LOX and LOX-like 1.
25979340 LOX activity is required in the control of collagen fibril architecture.
25825846 Serum sLOX-1 levels were independently correlated with the presence and severity of OSA.
25790191 these results corroborate the role of LOX in the migration, invasion and angiogenesis of astrocytomas. Furthermore, LOX expression is influenced by IDH1 mutational status.
25735481 Evidence for association was found for both of the tested loci.It was strongest for rs3735520:G>A near HGF with A allele being a risk factor and rs2956540:G>C within LOX with C allele having a protective effect
25593510 Attenuation of lysyl oxidase and collagen gene expression in keratoconus patient corneal epithelium corresponds to disease severity.
25501874 High lysyl oxidase expression level in amnion is associated with higher birth weight of Tibetan newborns.
25337249 LOX may play a role in the metastasis of non-small cell lung cancer by promoting MMP2/MMP9 expression. LOX expression is an independent prognostic factor for survival in NSCLC.
25174950 Study demonstrated that reactive oxygen species promote the migration and metastatic growth of ovarian cancer cells via upregulation of HIF-1a and LOX and E-cadherin repression.
25141126 High LOX expression was associated with a poor disease-free and metastasis-free survival in ER negative but not ER positive breast cancer patients.
25112403 The effect of LOX G473A polymorphism on cancer risk among Asians, was investigated.
25060181 LOX with CEA, CA724, CA199, and CA125 could increase the sensitivity of predicting lymph nodes metastasis and peritoneal metastasis in gastric cancer
24945327 This case-control study provided evidence that LOX polymorphisms were associated with increased susceptibility to cervical cancer, in which rs2278226 could increase serum levels of LOX in cervical cancer patients.
24804215 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24650661 miR-29b down-regulates HSP47 and LOX expression.
24574233 This study is the first to demonstrate high serum LOX levels in SSc patients that correlate specifically with skin fibrosis. These correlations suggest that LOX levels may serve as a novel biomarker of fibrosis.
24573150 lysyl oxidase propeptide inhibits hepatocellular carcinoma cell proliferation and induces its apoptosis
24502826 Our study demonstrated that the LOX rs1800449 genotypes (AA and GA + AA) and allele (A) appears to confer risk for susceptibility to keratoconus.
24265769 LOX, LOXL1 and LOXL2 are downstream PPARgamma targets and that LOX activity is a negative regulator of trophoblastic cell invasion
24167568 LOX-PP interacts with CIN85 via a novel SH3-binding motif and this association reduces CIN85-promoted invasion by breast cancer cells.
24113189 lysyl oxidase activity participates in primary tumor growth by directly impacting the senescence stability.
24065528 This study could not observe any significant role of LOX polymorphisms in influencing intracranial aneurysm.
23975428 RKIP, LOX and SDC2 are coordinately regulated and collectively encompass a prognostic signature for metastasis-free survival in ER-negative breast cancer patients
23970168 Loss of Protein-Lysine 6-Oxidase is associated with osteosarcoma.
23886186 Bisphenol A exposure interacts with the -22 G/C polymorphism of the LOX gene to increase the risk of osteosarcoma.
23758270 Polymorphism in LOX gene was associated with increased susceptibility to glioma and could be used as prognostic factor for this malignancy.
23750284 LOX displays tumor suppressor activities
23619422 An excess of osteopontin is associated with increased LOX and insoluble collagen, as well as with left ventricular stiffness and systolic dysfunction in patients with hypertensive heart failure.
23560895 Pterostilbene displayed significant potency to reduce LOX-mediated activity in E40 cells when combined with curcumin. Colony formation of E40 cells in soft agar was reduced by both genetic depletion of LOX and by chemical inhibitors of LOX expression.
23545606 Collectively, our study demonstrates that the hypoxia-HIF-1a, LOX-FAK/AKT pathway regulates the migration and invasion of epithelial ovarian cancer cells
23530115 Studies indicate that mesenchymal stem cells (MSC)-derived hyaluronan (HA) was sufficient and necessary to induce lysyl oxidase (LOX) and Twist in the cancer cells.
23494965 Data suggest that all members of LOX gene family (lysyl-oxidase [LOX]; lysyl oxidase-like proteins [LOXL1, LOXL2, LOXL3]) are over-expressed in bone marrow in primary myelofibrosis; LOX gene family is not detectable in normal bone marrow.
23413430 Suggest a causal relationship between LOX downregulation and aortic stiffening in obesity.
23413043 These results indicated that LOX polymorphisms were associated with increased susceptibility to rhegmatogenous retinal detachment and Proliferative vitreoretinopathy and suggest a potential correlation between LOX and ocular inflammation.
23357697 TGF-beta1 induced injured MCL to express more LOXs than injured ACL (up to 1.85-fold in LOX, 2.21-fold in LOXL-1, 1.71-fold in LOXL-2, 2.52-fold in LOXL-3 and 3.32-fold in LOXL-4).
23267843 conclude that the ECM modulating enzyme LOX is associated with amyloid-beta pathology in Alzheimer's disease and hereditary cerebral hemorrhage with amyloidosis--Dutch type.
23262025 The inhibition of LOX resulted in a decrease in invasion area, but only very mildly in invasion depth of oral carcinoma.
23188504 we show that LOX is clinically correlated with VEGF expression and blood vessel formation in 515 colorectal cancer patient samples.
23165370 Collectively, these findings suggest LOX enhances hypoxia-induced invasion and migration in cervical cancer cells mediated by the epithelial-mesenchymal transition.
22994786 LOX protein was positively correlated with MMP-2 and MMP-9.
22966818 the LOX activity, which is composite of all the isoforms, was reduced under high glucose conditions, there was a differential mRNA expression with increased LOX and LOXL1 and decreased LOXL2 expression.
22948781 LOX 473 G/A polymorphism is associated with increased risk of nonsmall cell lung cancer.
22883193 LOX, MMP-2, and MMP-9 may have a synergistic role in promoting invasion and metastasis of breast cancer.
22824984 Lysyl oxidase-mediated excessive collagen cross-linking facilitates the increase in left ventricular stiffness with the resulting elevation of filling pressures in hypertensive patients.
22767499 Studies indicate the contribution of megakaryocytes (MKs) to the progression of myelofibrosis with the newly identified role of lysyl oxidase (LOX).
22722997 The G473A polymorphism of LOX gene could be a new risk factor for ischemic stroke.
22533780 The data suggest that the G473A polymorphism of the LOX gene is associated with increased susceptibility to ovarian cancer.
22438909 Blimp1 is a mediator of Ras/Raf/AP-1 signaling that promotes cell migration, and is repressed by LOX-PP in lung cancer.
21995629 G473A polymorphism of the lysyl oxidase gene may be closely associated with susceptibility to the development and differentiation of gastric cancer in South Korean patients.
21740577 Human lysyl oxidase gene does not confer increased genotypic risk for adolescent idiopathic scoliosis.
21612403 A novel polymorphism in the LOX gene, G473A (rs1800449), was identified. Frequencies of LOX 473 AA genotype and A allele were significantly higher in patients with coronary artery disease than in controls.
21575462 Expressions of LOX and MMP-2 in gastric cancer tissues are significantly higher than that in pericancerous tissues, and are also higher in gastric cancer with lymph node metastasis.
21546528 Both Smad and non-Smad signaling pathways are involved in TGFbeta-mediated LOX induction, suggesting complex regulation of these important extracellular matrix cross-linking enzymes.
21536655 the interaction of LOX-PP with Hsp70 and c-Raf inhibits a critical intermediate in Ras-induced MEK signaling and plays an important role in the function of this tumor suppressor
21532881 LOX is a potential mediator that couples mechanotransduction to oncogenic signaling by TGF-beta1 and measures capable of inactivating LOX function may prove effective in diminishing breast cancer progression stimulated by TGF-beta1.
21318022 Review of down-regulation of lysyl oxidase expression in lung cells by components of cigarette smoke, indicating lysyl oxidase as a critical intra- and extracellular target for cigarette smoke pathogenesis in the lung.
21306648 Data show that CA9, GLUT1 and LOX mRNA levels were equally and strongly correlated to hypoxic extent in FaDudd, and the same was observed for CA9 and GLUT1, but not LOX, in SCCVII tumors.
21282564 LOX showed an important role in CRC cell proliferation and metastasis and was dependent on the activation of SRC. These results have the potential to identify patients with high SRC activity, who may benefit from dasatinib treatment.
21239473 these findings provide compelling evidence that LOX and HIF-1 act in synergy to foster tumor formation
21215756 Analysis revealed that left atrial appendage of atrial fibrillation patients are characterized by increased lysyl oxidase (LOX) mRNA (218 +/- 42%) and protein (253 +/- 11%) expression.
20956321 LKB1 loss of function promotes lung cancer malignancy through remodeling of extracellular matrix microenvironment, and identify LOX as a potential target for disease treatment in lung cancer patients.
20929399 LOX 473 GA genotype is independently associated with increased risk of breast cancer in Chinese female population.
20929399 Observational study of gene-disease association. (HuGE Navigator)
20812961 A finely regulated expression of LOX is necessary for normal keratinocyte differentiation and thus for maintenance of epidermal homeostasis.
20717923 requirement of the LOX-PrePeptide for pro-LOX exit from the ER and the influence of LOX-PP glycosylation on LOX enzyme activity.
20689807 Observational study of gene-disease association. (HuGE Navigator)
20498644 The loss of Pdcd4 early in cancer progression may have an important role in the increased sensitivity of cancer cells to hypoxia through increased LOX activity and concomitant enhanced invasiveness.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20179655 Our study is the first to show lysyl oxidase expression in primary choroidal melanomas.
20146053 Methylation in the promoter region may suppress LOX gene expression in women with pelvic organ prolapse
20026874 molecular pathway from hypoxia to cellular transformation includes up-regulation of HIF and subsequent transcriptional induction of LOX and LOXL2, which repress E-cadherin and induce epithelial to mesenchymal transition
19816945 Lysyl oxidase overexpression may be an early phenomenon in the pathogenesis of oropharyngeal squamous cell carcinoma and thus a noven target for chemopreventive and therapeutic strategies.
19724858 LOX upregulation may be associated with increased invasiveness and metastatic potential in colorectal cancer.
19667273 Study validates that LOX is a marker for metastasis and survival in HNC.
19661442 a causal relationship between mtDNA deletions, reactive oxygen species production, and increased LOX activity that leads to increased contraction of collagen gels
19654310 Genetic polymorphism as a mechanism of impaired tumor suppressor function of LOX-propeptide and it may play an etiologic role in ER-negative breast cancer.
19583806 LOX protein is overexpressed in polycystic ovarian tissue, and transcriptional activity of the LOX promoter is regulated by AGE signalling.
19526206 High Lysyl oxidase is associated with lymph node metastasis in esophageal squamous cell carcinoma.
19406911 Statins normalize vascular lysyl oxidase down-regulation induced by proatherogenic risk factors.
19394199 Report reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes.
19111879 demonstrate a critical role for LOX in premetastatic niche formation and support targeting LOX for the treatment and prevention of metastatic disease
19087518 The results suggest that decreased expression of elastin and LOX and increased expression of elafin in the cardinal ligaments may contribute to pelvic organ prolapse.
19029090 The lysyl oxidase pro-peptide attenuates fibronectin-mediated activation of focal adhesion kinase and p130Cas in breast cancer cells.
19020742 lysyl oxidase and glucose transporter-1 expression have roles in prostate cancer progression
18764858 There was a borderline of statistically significant difference in Arg158Gln genotype lying between control and OSF patients. G/A+A/A of LOX Arg158Gln in OSF patients older than 50 was statistically significantly higher than controls older than 50.
18764858 Observational study of gene-disease association. (HuGE Navigator)
18566459 LOX activity showed a statistically significant decrease in the vitreous of PDR and RRD relative to control specimens. This effect can contribute to the inadequate collagen cross-linking that causes the ECM changes that occur in these diseases.
17849172 LOX participates, in part, in the remodeling of the heart leading to cardiac dysfunction and heart failure.
17673218 By using both TNF receptor (TNFR) agonist and blocking antibodies we determined the involvement of TNFR2 on LOX down-regulation
17616686 BCL2 repression by the tumor suppressor activity of the lysyl oxidase propeptide inhibits transformed phenotype of lung and pancreatic cancer cells
17395448 LOX regulates the promoter of elastin, inducing an important activation of its activity.
16642001 findings indicate that LOX is essential for hypoxia-induced metastasis and is a good therapeutic target for preventing and treating metastases
16533769 Absence of lysyl oxidase is associated with basal and squamous cell carcinomas of the skin
16440329 LOX regulates cell motility/migration through changes in actin filament polymerization, which involve the regulation of the p130(Cas)/Crk/DOCK180
16357151 up-regulation of lysyl oxidase is associated with invasive breast cancer through a hydrogen peroxide-mediated mechanism involving the FAK/Src signaling pathway
16251195 pro-regions of lysyl oxidase and lysyl oxidase-like 1 are required for deposition onto elastic fibers
16023247 Upregulation of Lox in Wilson's disease could perhaps be utilized for diagnostic purposes since their expression is up-regulated in hepatocytes even before the onset of fibrosis.
15843371 the FN matrix may provide specific microenvironments to regulate LOX catalytic activity
15374948 LOX is a tumor suppressor gene inactivated by methylation and loss of heterozygosity in gastric cancers, and possibly also in other cancers.
15273433 Four genetic variants including 2 novel polymorphisms, 1 in the noncoding sequence of exon 7 and the other upstream from lysyl oxidase promoter. None showed allelic association or cosegregation with intracranial aneurysm in families.
15137057 LOX regulates control of normal collagen deposition in differentiating osteoblast cultures.
12820424 LOX-mRNA level in both cell lines and tissues of HNSCC was markedly reduced as opposed to benign keratinocyte cell lines and mucosal tissue samples of the upper aerodigestive tract suggesting that LOX is involved in tumor suppressive processes.
12750963 Observational study of gene-disease association. (HuGE Navigator)
12750963 No associations of intracranial aneurysm and LOX were found.
12686141 Lysyl oxidase(LOX) could actually interact specifically not only with histone H1, but also with histone H2.
12577300 comparison and aa sequence alignment of human and rat lysyl oxidase and lysyl oxidase-like gene (LOXL1); role in formation and repair of ECM elastin and collagen
12452073 lysyl oxidase gene may play an important role in metastasis of esophageal, cardiac, and gastric carcinomas
12101112 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11807790 Loss or reduction of LOX function during tumor development is a direct consequence of somatic mutations and associated with colon tumor pathogenesis.
11675877 Observational study of gene-disease association. (HuGE Navigator)
11675877 Polymorphisms of the LOX gene were genotyped in 192 ALS patients, including 31 unrelated familial cases and 138 controls, and no association was found between any of these polymorphisms and amyotrophic lateral sclerosis or its phenotype.

AA Sequence

MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRR      1 - 70
DPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGAS     71 - 140
RAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQY    141 - 210
GLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPS    211 - 280
RPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG    281 - 350
CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY       351 - 417
//

Text Mined References (151)

PMID Year Title
26908052 2016 Forkhead Box F1 promotes breast cancer cell migration by upregulating lysyl oxidase and suppressing Smad2/3 signaling.
26893379 2016 Fibromodulin Interacts with Collagen Cross-linking Sites and Activates Lysyl Oxidase.
26838787 2016 LOX Mutations Predispose to Thoracic Aortic Aneurysms and Dissections.
26713757 2015 Association of Common Variants in LOX with Keratoconus: A Meta-Analysis.
26601954 2016 Characterization of Microfibrillar-associated Protein 4 (MFAP4) as a Tropoelastin- and Fibrillin-binding Protein Involved in Elastic Fiber Formation.
26515140 2016 Lysyl oxidase mediates hypoxia-induced radioresistance in non-small cell lung cancer A549 cells.
26437801 2015 Copper Transport Protein Antioxidant-1 Promotes Inflammatory Neovascularization via Chaperone and Transcription Factor Function.
26085300 2015 Lysyl Oxidase as a Serum Biomarker of Liver Fibrosis in Patients with Severe Obesity and Obstructive Sleep Apnea.
26077591 2015 Targeting the LOX/hypoxia axis reverses many of the features that make pancreatic cancer deadly: inhibition of LOX abrogates metastasis and enhances drug efficacy.
26048020 2015 Lysyl Oxidase Is Predictive of Unfavorable Outcomes and Essential for Regulation of Vascular Endothelial Growth Factor in Hepatocellular Carcinoma.
26017313 2015 The hypoxic cancer secretome induces pre-metastatic bone lesions through lysyl oxidase.
26011922 2016 Screening of lysyl oxidase (LOX) and lysyl oxidase like (LOXL) enzyme expression and activity in preterm prelabor rupture of fetal membranes.
25988230 2015 Elevated expression levels of lysyl oxidases protect against aortic aneurysm progression in Marfan syndrome.
25979340 2015 Lysyl Oxidase Activity Is Required for Ordered Collagen Fibrillogenesis by Tendon Cells.
25825846 2015 Serum sLOX-1 Levels Are Correlated with the Presence and Severity of Obstructive Sleep Apnea.
25790191 2015 LOX expression and functional analysis in astrocytomas and impact of IDH1 mutation.
25735481 2015 Validation of rs2956540:G>C and rs3735520:G>A association with keratoconus in a population of European descent.
25593510 2015 Attenuation of lysyl oxidase and collagen gene expression in keratoconus patient corneal epithelium corresponds to disease severity.
25501874 2014 Two functional loci in the promoter of EPAS1 gene involved in high-altitude adaptation of Tibetans.
25337249 2014 Correlations of lysyl oxidase with MMP2/MMP9 expression and its prognostic value in non-small cell lung cancer.
25174950 2014 Reactive oxygen species promote ovarian cancer progression via the HIF-1?/LOX/E-cadherin pathway.
25141126 2014 Association of the G473A polymorphism and expression of lysyl oxidase with breast cancer risk and survival in European women: a hospital-based case-control study.
25118846 2014 Nuclear translocation of lysyl oxidase is promoted by interaction with transcription repressor p66?.
25112403 2015 Lysyl oxidase rs1800449 polymorphism and cancer risk among Asians: evidence from a meta-analysis and a case-control study of colorectal cancer.
25060181 2014 Combined use of lysyl oxidase, carcino-embryonic antigen, and carbohydrate antigens improves the sensitivity of biomarkers in predicting lymph node metastasis and peritoneal metastasis in gastric cancer.
24945327 2014 Lysyl oxidase genetic variants affect gene expression in cervical cancer.
24804215 2014 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24650661 2014 MiR-29b inhibits collagen maturation in hepatic stellate cells through down-regulating the expression of HSP47 and lysyl oxidase.
24574233 2014 Brief report: lysyl oxidase is a potential biomarker of fibrosis in systemic sclerosis.
24573150 2014 Expression of the lysyl oxidase propeptide in hepatocellular carcinoma and its clinical relevance.
24502826 2015 Association of Lysyl oxidase (LOX) Polymorphisms with the Risk of Keratoconus in an Iranian Population.
24265769 2013 Transcriptome analysis of PPAR? target genes reveals the involvement of lysyl oxidase in human placental cytotrophoblast invasion.
24167568 2013 Inhibition of CIN85-mediated invasion by a novel SH3 domain binding motif in the lysyl oxidase propeptide.
24113189 2013 Lysyl oxidase activity regulates oncogenic stress response and tumorigenesis.
24065528 2013 Lack of association of lysyl oxidase (LOX) gene polymorphisms with intracranial aneurysm in a south Indian population.
23975428 2014 RKIP and HMGA2 regulate breast tumor survival and metastasis through lysyl oxidase and syndecan-2.
23970168 2013 Expression of lysyl oxidase in human osteosarcoma and its clinical significance: a tumor suppressive role of LOX in human osteosarcoma cells.
23886186 2013 Interactive effect of bisphenol A (BPA) exposure with -22G/C polymorphism in LOX gene on the risk of osteosarcoma.
23758270 2014 Lysyl oxidase genetic variants and the prognosis of glioma.
23750284 2013 Lysyl oxidase is downregulated by the EWS/FLI1 oncoprotein and its propeptide domain displays tumor supressor activities in Ewing sarcoma cells.
23619422 2013 Osteopontin-mediated myocardial fibrosis in heart failure: a role for lysyl oxidase?
23560895 2013 Long-term ethanol exposure-induced hepatocellular carcinoma cell migration and invasion through lysyl oxidase activation are attenuated by combined treatment with pterostilbene and curcumin analogues.
23545606 2013 Hypoxia inducible factor 1?-mediated LOX expression correlates with migration and invasion in epithelial ovarian cancer.
23530115 2013 Lysyl oxidase at the crossroads of mesenchymal stem cells and epithelial-mesenchymal transition.
23494965 2013 The expression of lysyl-oxidase gene family members in myeloproliferative neoplasms.
23413430 2013 Increased aortic stiffness and attenuated lysyl oxidase activity in obesity.
23413043 2013 Effects of lysyl oxidase genetic variants on the susceptibility to rhegmatogenous retinal detachment and proliferative vitreoretinopathy.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23357697 2013 TGF-beta1 induces the different expressions of lysyl oxidases and matrix metalloproteinases in anterior cruciate ligament and medial collateral ligament fibroblasts after mechanical injury.
23267843 2013 Extracellular matrix modulator lysyl oxidase colocalizes with amyloid-beta pathology in Alzheimer's disease and hereditary cerebral hemorrhage with amyloidosis--Dutch type.
23262025 2013 The hypoxic tumor microenvironment regulates invasion of aggressive oral carcinoma cells.
23188504 2013 Lysyl oxidase plays a critical role in endothelial cell stimulation to drive tumor angiogenesis.
23165370 2013 Inactivation of lysyl oxidase by ?-aminopropionitrile inhibits hypoxia-induced invasion and migration of cervical cancer cells.
22994786 2012 Silencing of lysyl oxidase gene expression by RNA interference suppresses metastasis of breast cancer.
22966818 2013 High glucose induced differential expression of lysyl oxidase and its isoform in ARPE-19 cells.
22948781 2012 The effect of lysyl oxidase polymorphism on susceptibility and prognosis of nonsmall cell lung cancer.
22883193 2012 [Mechanism of lysyl oxidase (LOX) in breast cancer invasion and metastasis].
22824984 2012 Collagen cross-linking but not collagen amount associates with elevated filling pressures in hypertensive patients with stage C heart failure: potential role of lysyl oxidase.
22810810 2012 The rationale for targeting the LOX family in cancer.
22767499 2012 Megakaryocyte pathology and bone marrow fibrosis: the lysyl oxidase connection.
22722997 2012 Lysyl oxidase polymorphisms and ischemic stroke--a case control study.
22533780 2012 Lysyl oxidase G473A polymorphism is associated with increased risk of ovarian cancer.
22438909 2012 Blimp1 activation by AP-1 in human lung cancer cells promotes a migratory phenotype and is inhibited by the lysyl oxidase propeptide.
21995629 2011 Lysyl oxidase G473A polymorphism is closely associated with susceptibility to gastric cancer in a South Korean population.
21740577 2011 Common polymorphisms in human lysyl oxidase genes are not associated with the adolescent idiopathic scoliosis phenotype.
21690299 2011 The lysyl oxidase propeptide interacts with the receptor-type protein tyrosine phosphatase kappa and inhibits ?-catenin transcriptional activity in lung cancer cells.
21612403 2011 Lysyl oxidase G473A polymorphism is associated with increased risk of coronary artery diseases.
21575462 2011 [Expression of LOX and MMP-2 in gastric cancer tissue and the effects of LOX and MMP-2 on tumor invasion and metastasis].
21546528 2011 Transforming growth factor-beta induces extracellular matrix protein cross-linking lysyl oxidase (LOX) genes in human trabecular meshwork cells.
21536655 2011 The Ras signaling inhibitor LOX-PP interacts with Hsp70 and c-Raf to reduce Erk activation and transformed phenotype of breast cancer cells.
21532881 2011 Lysyl oxidase contributes to mechanotransduction-mediated regulation of transforming growth factor-? signaling in breast cancer cells.
21318022 2011 Lysyl oxidase, a critical intra- and extra-cellular target in the lung for cigarette smoke pathogenesis.
21306648 2011 In vivo identification and specificity assessment of mRNA markers of hypoxia in human and mouse tumors.
21282564 2011 The role of lysyl oxidase in SRC-dependent proliferation and metastasis of colorectal cancer.
21239473 2011 The HIF-1-inducible lysyl oxidase activates HIF-1 via the Akt pathway in a positive regulation loop and synergizes with HIF-1 in promoting tumor cell growth.
21215756 2011 Increased lysyl oxidase expression and collagen cross-linking during atrial fibrillation.
20956321 2010 LKB1 inhibits lung cancer progression through lysyl oxidase and extracellular matrix remodeling.
20929399 2011 Lysyl oxidase 473 G>A polymorphism and breast cancer susceptibility in Chinese Han population.
20812961 2010 Lysyl oxidase silencing impairs keratinocyte differentiation in a reconstructed-epidermis model.
20717923 2010 Role of lysyl oxidase propeptide in secretion and enzyme activity.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20498644 2010 Pdcd4 repression of lysyl oxidase inhibits hypoxia-induced breast cancer cell invasion.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20179655 2010 Lysyl oxidase expression and inhibition in uveal melanoma.
20146053 2010 Suppression of lysyl oxidase gene expression by methylation in pelvic organ prolapse.
20026874 2010 The lysyl oxidases LOX and LOXL2 are necessary and sufficient to repress E-cadherin in hypoxia: insights into cellular transformation processes mediated by HIF-1.
19816945 2010 Lysyl oxidase expression is an independent marker of prognosis and a predictor of lymph node metastasis in oral and oropharyngeal squamous cell carcinoma (OSCC).
19724858 2009 Differential expression of the LOX family genes in human colorectal adenocarcinomas.
19667273 2009 Validation of lysyl oxidase as a prognostic marker for metastasis and survival in head and neck squamous cell carcinoma: Radiation Therapy Oncology Group trial 90-03.
19661442 2009 Functional consequences of mitochondrial DNA deletions in human skin fibroblasts: increased contractile strength in collagen lattices is due to oxidative stress-induced lysyl oxidase activity.
19654310 2009 A loss-of-function polymorphism in the propeptide domain of the LOX gene and breast cancer.
19583806 2010 Lysyl oxidase interacts with AGE signalling to modulate collagen synthesis in polycystic ovarian tissue.
19570982 2009 Differential regulation of elastic fiber formation by fibulin-4 and -5.
19526206 2009 Expression of lysyl oxidase is correlated with lymph node metastasis and poor prognosis in esophageal squamous cell carcinoma.
19406911 2009 Statins normalize vascular lysyl oxidase down-regulation induced by proatherogenic risk factors.
19394199 2009 Reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes.
19111879 2009 Hypoxia-induced lysyl oxidase is a critical mediator of bone marrow cell recruitment to form the premetastatic niche.
19087518 2008 [Expression of elastin, lysyl oxidase and elafin in the cardinal ligament of women with pelvic organ prolapse].
19029090 2009 The lysyl oxidase pro-peptide attenuates fibronectin-mediated activation of focal adhesion kinase and p130Cas in breast cancer cells.
19020742 2008 Analysis of hypoxia-associated gene expression in prostate cancer: lysyl oxidase and glucose transporter-1 expression correlate with Gleason score.
18764858 2009 Association between lysyl oxidase polymorphisms and oral submucous fibrosis in older male areca chewers.
18566459 2008 Lysyl oxidase activity in the ocular tissues and the role of LOX in proliferative diabetic retinopathy and rhegmatogenous retinal detachment.
17849172 2008 Upregulation of lysyl oxidase and MMPs during cardiac remodeling in human dilated cardiomyopathy.
17673218 2008 Lysyl oxidase (LOX) down-regulation by TNFalpha: a new mechanism underlying TNFalpha-induced endothelial dysfunction.
17616686 2007 Repression of BCL2 by the tumor suppressor activity of the lysyl oxidase propeptide inhibits transformed phenotype of lung and pancreatic cancer cells.
17395448 2007 Regulation of elastin promoter by lysyl oxidase and growth factors: cross control of lysyl oxidase on TGF-beta1 effects.
16642001 2006 Lysyl oxidase is essential for hypoxia-induced metastasis.
16533769 2006 The lysyl oxidase LOX is absent in basal and squamous cell carcinomas and its knockdown induces an invading phenotype in a skin equivalent model.
16440329 2006 Lysyl oxidase regulates actin filament formation through the p130(Cas)/Crk/DOCK180 signaling complex.
16357151 2005 Lysyl oxidase regulates breast cancer cell migration and adhesion through a hydrogen peroxide-mediated mechanism.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16251195 2005 The Pro-regions of lysyl oxidase and lysyl oxidase-like 1 are required for deposition onto elastic fibers.
16023247 2005 Abnormal deposition of collagen around hepatocytes in Wilson's disease is associated with hepatocyte specific expression of lysyl oxidase and lysyl oxidase like protein-2.
15843371 2005 Cellular fibronectin binds to lysyl oxidase with high affinity and is critical for its proteolytic activation.
15609325 2005 Identification and validation of novel ERBB2 (HER2, NEU) targets including genes involved in angiogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15374948 2004 Lysyl oxidase is a tumor suppressor gene inactivated by methylation and loss of heterozygosity in human gastric cancers.
15273433 2004 Mutations in the lysyl oxidase gene not associated with intracranial aneurysm in central European families.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15137057 2004 A role for lysyl oxidase regulation in the control of normal collagen deposition in differentiating osteoblast cultures.
15110773 2004 In vivo interaction between the human dehydrodolichyl diphosphate synthase and the Niemann-Pick C2 protein revealed by a yeast two-hybrid system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12820424 Reduction of LOX- and LOXL2-mRNA expression in head and neck squamous cell carcinomas.
12750963 2003 Association of positional and functional candidate genes FGF1, FBN2, and LOX on 5q31 with intracranial aneurysm.
12686141 2003 Demonstration of in vitro interaction between tumor suppressor lysyl oxidase and histones H1 and H2: definition of the regions involved.
12577300 2003 Lysyl oxidase: properties, specificity, and biological roles inside and outside of the cell.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452073 2002 [Expression of lysyl oxidase gene in upper digestive tract carcinomas and its clinical significance].
12101112 2002 Interaction of collagen-related genes and susceptibility to betel quid-induced oral submucous fibrosis.
11916256 2001 Characterization of the region encompassing the human lysyl oxidase locus.
11642359 2001 Lysyl oxidases: a novel multifunctional amine oxidase family.
10391127 1999 Epigenetic inhibition of lysyl oxidase transcription after transformation by ras oncogene.
9111998 1997 Congenital cutis laxa and lysyl oxidase deficiency.
8636146 1996 Metalloproteinase activity secreted by fibrogenic cells in the processing of prolysyl oxidase. Potential role of procollagen C-proteinase.
8442432 1993 Collagen crosslinks and mineral crystallinity in bone of patients with osteogenesis imperfecta.
8100215 1993 A restriction fragment length polymorphism results in a nonconservative amino acid substitution encoded within the first exon of the human lysyl oxidase gene.
8082810 1994 Tyrosine-rich acidic matrix protein (TRAMP) is a tyrosine-sulphated and widely distributed protein of the extracellular matrix.
7902322 1993 Structure of the human lysyl oxidase gene.
7706256 1995 A new gene with sequence and structural similarity to the gene encoding human lysyl oxidase.
6912069 1981 Reactivity of human leukocyte elastase and porcine pancreatic elastase toward peptide 4-nitroanilides containing model desmosine residues. Evidence that human leukocyte elastase is selective for cross-linked regions of elastin.
6147899 1984 Inhibition of collagen fibril formation in vitro and subsequent cross-linking by glucose.
6144680 1984 Human placental lysyl oxidase. Purification, partial characterization, and preparation of two specific antisera to the enzyme.
6127904 1982 Effect of cortisol on the proliferation and protein synthesis of human aortic smooth muscle cells in culture.
3120785 1987 Analysis of age-associated changes in collagen crosslinking in the skin and lung in monkeys and rats.
2874833 1986 Secretion of lysyl oxidase by cultured human skin fibroblasts and effects of monensin, nigericin, tunicamycin and colchicine.
2863189 1985 Increased lysyl oxidase activity in culture medium of nonparenchymal cells from fibrotic livers.
1685472 1991 Molecular cloning of human lysyl oxidase and assignment of the gene to chromosome 5q23.3-31.2.
1683640 1991 Serum lysyl oxidase activity in chronic liver disease in comparison with serum levels of prolyl hydroxylase and laminin.
1357535 1992 The complete derived amino acid sequence of human lysyl oxidase and assignment of the gene to chromosome 5 (extensive sequence homology with the murine ras recision gene).
1352776 1992 Characterization of the human lysyl oxidase gene locus.