Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.800 1.0e-02
posterior fossa group A ependymoma -2.800 8.5e-15
glioblastoma -2.700 3.7e-05
oligodendroglioma -1.600 1.5e-15
group 3 medulloblastoma -3.600 1.1e-03
atypical teratoid / rhabdoid tumor -1.900 3.1e-03
medulloblastoma, large-cell -4.000 1.2e-03
primitive neuroectodermal tumor -1.300 6.5e-03
Duchenne muscular dystrophy -1.025 4.3e-05
limb girdle muscular dystrophy 2B -1.023 8.4e-04
Amyotrophic Lateral Sclerosis 1.265 8.1e-06
adrenocortical carcinoma -1.964 2.7e-03
intraductal papillary-mucinous carcinoma... -2.000 1.8e-02
pancreatic cancer -1.400 7.7e-04
adult high grade glioma -2.400 9.0e-05
pilocytic astrocytoma -1.700 1.4e-05
invasive ductal carcinoma -1.452 1.9e-02
lung carcinoma 2.000 2.0e-27
Pick disease 1.500 1.7e-02
ovarian cancer -3.400 3.5e-05
chronic rhinosinusitis -1.067 8.8e-03
psoriasis -1.400 1.1e-49

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
23333304 HIV-1 Vif downregulates the expression of LON peptidase N-terminal domain and ring finger 2 (LONRF2) in Vif-expression T cells
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSPEPVPPPPPPQCPGCDRAEPIAQRLEEGDEAFRAGDYEMAAELFRSMLAGLAQPDRGLCLRLGDALAR      1 - 70
AGRLPEALGAFRGAARLGALRPEELEELAGGLVRAVGLRDRPLSAENPGGEPEAPGEGGPAPEPRAPRDL     71 - 140
LGCPRCRRLLHKPVTLPCGLTVCKRCVEPGPARPQVRRVNVVLSGLLEKCFPAECRLRRLAGQARSLQRQ    141 - 210
QQPEAALLRCDQALELAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGR    211 - 280
SKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGD    281 - 350
AGSSENSSEKSDMLGNTNSSVLYFILGLHFEEDKKALESILPTAPSAGLKRQFPDDVEDAPDLNAPGKIP    351 - 420
KKDLSLQRSPNSETEESQGLSLDVTDFECALCMRLLFEPVTTPCGHTFCLKCLERCLDHAPHCPLCKDKL    421 - 490
SELLASRNFNITVLAEELIFRYLPDELSDRKRIYDEEMSELSNLTRDVPIFVCAMAFPTVPCPLHVFEPR    491 - 560
YRLMIRRCMETGTKRFGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHRDGYNT    561 - 630
ADIEYLEDEKVEGPEYEELAALHDSVHQQSVSWFASLQDRMKEQILSHFGVMPDREPEPQSNPSGPAWSW    631 - 700
WILAVLPLERKAQLAILGMTSLKERLLAIRRILVIITRKMNSRQELANARERNN                    701 - 754
//

Text Mined References (6)

PMID Year Title
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.