Property Summary

NCBI Gene PubMed Count 35
PubMed Score 32.08
PubTator Score 26.93

Knowledge Summary

Patent (2,937)

Expression

  Differential Expression (15)

Gene RIF (27)

PMID Text
26559041 Mutation of the di-acidic export motif led to endoplasmic reticulum retention of LMTK2, and an increase in protein half-life.
26008968 Lemur Tyrosine Kinase-2 (LMTK2), negatively regulates androgen-dependent and androgen-independent prostate cancer cell proliferation. In addition, LMTK2 also negatively regulates the androgen receptor transcriptional activity.
24727471 Data indicate that Lemur tyrosine kinase 2 (LMTK2) localizes at the plasma membrane and co-immunoprecipitates with cystic fibrosis transmembrane conductance regulator (CFTR) in airway epithelial cells.
23114966 The results indicate that lemur tyrosine kinase 2 is an integral membrane protein in which both the amino and carboxyl termini are exposed to the cytoplasm. Moreover, this topology places the kinase active site within the cytoplasm.
22220831 We describe a new signalling pathway within the nervous system that links cdk5/p35 with phosphatase-1C and which has implications for a number of neuronal functions and neuronal dysfunction
21071540 Observational study of gene-disease association. (HuGE Navigator)
20878950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20569440 Low LMTK2 expression is associated with the development of prostate cancer.
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
20460480 Observational study of gene-disease association. (HuGE Navigator)
20450899 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19902474 Observational study of gene-disease association. (HuGE Navigator)
19900942 Observational study of gene-disease association. (HuGE Navigator)
19866473 Observational study of gene-disease association. (HuGE Navigator)
19855435 Data show that downregulation of myosin VI expression results in a significant reduction in PSA and VEGF secretion in LNCaP cells, and the intracellular targeting seems to involve myosin VI-interacting proteins, GIPC and LMTK2 and Dab2.
19549807 Observational study of gene-disease association. (HuGE Navigator)
19423541 Observational study of gene-disease association. (HuGE Navigator)
19366831 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19318432 Observational study of gene-disease association. (HuGE Navigator)
18794092 Observational study of gene-disease association. (HuGE Navigator)
18429820 Results show that BREK is critical for the transition of endocytosed membrane vesicles from early endosomes to recycling endosomes and also suggest an involvement of myosin VI in this pathway.
18264097 Genome-wide association study of gene-disease association. (HuGE Navigator)
18029400 Myosin VI and LMTK2 are required for the transport of cargo, such as the Transferrin Receptor, from early endosomes to the endocytic recycling compartment.
16428298 role of the segment KLHY in binding with protein phosphatase 1
15005709 BREK, Brain Enriched Kinase, is a new member of the family of protein serine/threonine kinases; plays important roles in NGF-TrkA signalling in the brain [BREK]
12832520 Cprk is expressed in a number of tissues but is enriched in brain and muscle; Cprk displays catalytic activity in kinase assays and is itself phosphorylated by cdk5/p35; Cdk5/p35 inhibits cprk activity
12393858 KPI-2 is a kinase with sites to associate with PP1C and Inh2 to form a regulatory complex that is localized to membranes

AA Sequence

MPGPPALRRRLLLLLLVLLIAGSAGAAPLPQTGAGEAPPAAEVSSSFVILCVCSLIILIVLIANCVSCCK      1 - 70
DPEIDFKEFEDNFDDEIDFTPPAEDTPSVQSPAEVFTLSVPNISLPAPSQFQPSVEGLKSQVARHSLNYI     71 - 140
QEIGNGWFGKVLLGEIYTGTSVARVIVKELKASANPKEQDTFLKNGEPYYILQHPNILQCVGQCVEAIPY    141 - 210
LLVFEFCDLGDLKAYLRSEQEHMRGDSQTMLLQRMACEVAAGLAAMHKLHFLHSDLALRNCFLTSDLNVK    211 - 280
VGDYGIGFSRYKEDYIETDDKKVFPLRWTAPELVTSFQDRLLTADQTKYSNIWSLGVTLWELFDNAAQPY    281 - 350
SNLSNLDVLNQVIRERDTKLPKPQLEQPYSDRWYEVLQFCWLSPEKRPAAEDVHRLLTYLRLQSQRDSEV    351 - 420
DFEQQWNALKPNTNSRDSSNNAAFPILDHFARDRLGREMEEVLTVTETSQGLSFEYVWEAAKHDHFDERS    421 - 490
RGHLDEGLSYTSIFYPVEVFESSLSDPGPGKQDDSGQDVPLRVPGVVPVFDAHNLSVGSDYYIQLEEKSG    491 - 560
SNLELDYPPALLTTDMDNPERTGPELSQLTALRSVELEESSTDEDFFQSSTDPKDSSLPGDLHVTSGPES    561 - 630
PFNNIFNDVDKSEDLPSHQKIFDLMELNGVQADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLC    631 - 700
LSDNLMHQDNFDPLNVQELSENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTE    701 - 770
LQFAENKPGLSLLQENVSTKGDDTDVMLTGDTLSTSLQSSPEVQVPPTSFETEETPRRVPPDSLPTQGET    771 - 840
QPTCLDVIVPEDCLHQDISPDAVTVPVEILSTDARTHSLDNRSQDSPGESEETLRLTESDSVLADDILAS    841 - 910
RVSVGSSLPELGQELHNKPFSEDHHSHRRLEKNLEAVETLNQLNSKDAAKEAGLVSALSSDSTSQDSLLE    911 - 980
DSLSAPFPASEPSLETPDSLESVDVHEALLDSLGSHTPQKLVPPDKPADSGYETENLESPEWTLHPAPEG    981 - 1050
TADSEPATTGDGGHSGLPPNPVIVISDAGDGHRGTEVTPETFTAGSQGSYRDSAYFSDNDSEPEKRSEEV   1051 - 1120
PGTSPSALVLVQEQPLPEPVLPEQSPAAQDSCLEARKSQPDESCLSALHNSSDLELRATPEPAQTGVPQQ   1121 - 1190
VHPTEDEASSPWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPD   1191 - 1260
IEGKYLGKLGVSGMLDLSEDGMDADEEDENSDDSDEDLRAFNLHSLSSESEDETEHPVPIILSNEDGRHL   1261 - 1330
RSLLKPTAANAPDPLPEDWKKEKKAVTFFDDVTVYLFDQETPTKELGPCGGEACGPDLSGPAPASGSPYL   1331 - 1400
SRCINSESSTDEEGGGFEWDDDFSPDPFMSKTTSNLLSSKPSLQTSKYFSPPPPARSTEQSWPHSAPYSR   1401 - 1470
FSISPANIASFSLTHLTDSDIEQGGSSEDGEKD                                        1471 - 1503
//

Text Mined References (39)

PMID Year Title
26559041 2015 Signal dependent ER export of lemur tyrosine kinase 2.
26008968 2015 Lemur Tyrosine Kinase 2, a novel target in prostate cancer therapy.
24727471 2014 LMTK2-mediated phosphorylation regulates CFTR endocytosis in human airway epithelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23114966 2013 Determination of the membrane topology of lemur tyrosine kinase 2 (LMTK2) by fluorescence protease protection.
22220831 2012 Cdk5/p35 phosphorylates lemur tyrosine kinase-2 to regulate protein phosphatase-1C phosphorylation and activity.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20878950 2011 Inherited genetic markers discovered to date are able to identify a significant number of men at considerably elevated risk for prostate cancer.
20569440 2010 Alterations in LMTK2, MSMB and HNF1B gene expression are associated with the development of prostate cancer.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
20460480 2010 Susceptibility loci associated with prostate cancer progression and mortality.
20450899 2010 Individual and cumulative association of prostate cancer susceptibility variants with clinicopathologic characteristics of the disease.
19902474 2010 Replication of prostate cancer risk loci on 8q24, 11q13, 17q12, 19q33, and Xp11 in African Americans.
19900942 2009 Prognostic significance of prostate cancer susceptibility variants on prostate-specific antigen recurrence after radical prostatectomy.
19866473 2010 Association of 17 prostate cancer susceptibility loci with prostate cancer risk in Chinese men.
19855435 2010 Overexpression of myosin VI in prostate cancer cells enhances PSA and VEGF secretion, but has no effect on endocytosis.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19549807 2009 Prostate cancer risk associated loci in African Americans.
19423541 2009 Established prostate cancer susceptibility variants are not associated with disease outcome.
19366831 2009 Analysis of recently identified prostate cancer susceptibility loci in a population-based study: associations with family history and clinical features.
19318432 2009 Generalizability of associations from prostate cancer genome-wide association studies in multiple populations.
18794092 2008 Association of prostate cancer risk variants with clinicopathologic characteristics of the disease.
18429820 2008 BREK/LMTK2 is a myosin VI-binding protein involved in endosomal membrane trafficking.
18264097 2008 Multiple newly identified loci associated with prostate cancer susceptibility.
18029400 2007 Myosin VI and its interacting protein LMTK2 regulate tubule formation and transport to the endocytic recycling compartment.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16887929 2006 Peptide microarray analysis of substrate specificity of the transmembrane Ser/Thr kinase KPI-2 reveals reactivity with cystic fibrosis transmembrane conductance regulator and phosphorylase.
16428298 2005 Characterization of the protein phosphatase 1-binding motifs of inhibitor-2 and DARPP-32 by surface plasmon resonance.
15005709 2004 Involvement of BREK, a serine/threonine kinase enriched in brain, in NGF signalling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12832520 2003 Identification of a novel, membrane-associated neuronal kinase, cyclin-dependent kinase 5/p35-regulated kinase.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393858 2002 A novel transmembrane Ser/Thr kinase complexes with protein phosphatase-1 and inhibitor-2.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.