Property Summary

NCBI Gene PubMed Count 19
PubMed Score 111.98
PubTator Score 551.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis -1.800 5.3e-04
cystic fibrosis -1.998 2.2e-06
acute quadriplegic myopathy -1.183 2.9e-03
adrenocortical carcinoma -2.924 1.3e-07
non-small cell lung cancer -1.719 2.1e-16
intraductal papillary-mucinous adenoma (... -1.400 1.4e-05
intraductal papillary-mucinous carcinoma... -1.500 2.5e-05
intraductal papillary-mucinous neoplasm ... -1.500 6.0e-04
colon cancer -2.700 5.0e-06
breast carcinoma -1.800 1.2e-32
fibroadenoma -1.100 1.8e-02
pilocytic astrocytoma 1.300 9.8e-04
subependymal giant cell astrocytoma 1.410 3.3e-02
lung adenocarcinoma -1.201 4.1e-07
Pick disease 1.100 4.8e-02
Breast cancer -2.700 2.0e-50
ductal carcinoma in situ -1.900 1.2e-04
invasive ductal carcinoma -2.800 1.0e-04

Gene RIF (11)

PMID Text
22157009 Lmod1 is a new SMC-restricted SRF/MYOCD target gene.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
16633140 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11350761 Lmod1 is a component of the smooth muscle contractile apparatus extractable by high salt, not a transmembrane protein as previously predicted.
11318603 Lmod1 is a member of the Tropomodulin family of actin binding proteins, and is most highly expressed in smooth muscle.
10520227 Lmod1, formerly the 64kD human autoantigen D1, is expressed in smooth muscle and striated extraocular slow muscle fibers, colocalized with myosin in the contractile apparatus. Protein levels are unaltered by hyperthyroidism.

AA Sequence

MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLN      1 - 70
FCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDE     71 - 140
AGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREE    141 - 210
MKEVAKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEK    211 - 280
EAKDDSKTKTPEKQTPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVR    281 - 350
FTEALEFNTVVKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL    351 - 420
RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQEQRQAQEAKG    421 - 490
EKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQR    491 - 560
KMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ                                  561 - 600
//

Text Mined References (22)

PMID Year Title
27144530 2016 MEF2C-MYOCD and Leiomodin1 Suppression by miRNA-214 Promotes Smooth Muscle Cell Phenotype Switching in Pulmonary Arterial Hypertension.
26370058 2015 How Leiomodin and Tropomodulin use a common fold for different actin assembly functions.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22157009 2012 Leiomodin 1, a new serum response factor-dependent target gene expressed preferentially in differentiated smooth muscle cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16633140 2006 Risperidone-related weight gain: genetic and nongenetic predictors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14627618 2003 Smooth muscle contraction and relaxation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11350761 2001 Leiomodin and tropomodulin in smooth muscle.
11318603 2001 Leiomodins: larger members of the tropomodulin (Tmod) gene family.
10520227 1999 Localization of the human 64kD autoantigen D1 to myofibrils in a subset of extraocular muscle fibers.
8811043 1996 Tissue distribution and quantitation of a gene expressing a 64-kDa antigen associated with thyroid-associated ophthalmopathy.
2026759 1991 Cloning and sequencing of a novel 64-kDa autoantigen recognized by patients with autoimmune thyroid disease.