Property Summary

NCBI Gene PubMed Count 106
PubMed Score 195.09
PubTator Score 161.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.174 7.7e-03
chronic lymphosyte leukemia -1.900 9.4e-18
glioblastoma 2.000 4.3e-03
osteosarcoma -2.764 4.2e-06
tuberculosis 1.700 5.1e-06
non-small cell lung cancer -1.853 4.5e-23
intraductal papillary-mucinous adenoma (... -1.600 4.4e-03
intraductal papillary-mucinous carcinoma... -1.900 2.4e-03
breast carcinoma -1.100 1.0e-05
group 3 medulloblastoma 1.400 1.3e-02
pilocytic astrocytoma 1.600 5.0e-07
primary Sjogren syndrome 1.200 1.1e-02
subependymal giant cell astrocytoma 1.872 3.9e-02
lung adenocarcinoma -2.000 4.2e-12
nasopharyngeal carcinoma -1.600 1.8e-05
Breast cancer -1.200 9.8e-07
invasive ductal carcinoma -1.500 1.6e-03
ulcerative colitis 1.600 1.5e-04
ovarian cancer -2.000 2.3e-06
chronic rhinosinusitis -1.461 9.8e-03

Gene RIF (66)

PMID Text
26598604 Alanine scanning mutagenesis of the LIM interaction domain of LDB1 revealed a discrete motif, R(320)LITR, required for LMO2 binding.
26161748 Data show that the Lim domain only 2 (LMO2) regulatory element (element-25) region consists of transcription factor GATA2-binding myeloid ennhancer and RUNX protein-binding T-cell repressor.
25721045 LMO2 expression was elevated in GBM tissues and inversely correlated with prognosis of GBM patients. Taken together, our findings describe novel dual roles of LMO2 to induce tumorigenesis and angiogenesis.
25710580 that suppression of MIR223 expression, as compared with controls, is associated with lack of differentiation and adverse cytogenetic profile, but unrelated with LMO2 protein expression or overall survival.
25682596 Cryptic chromosomal rearrangements in the LMO2 gene were associated with T-cell acute lymphoblastic leukemia.
25499232 results suggest that E47 has diverse effects in T-ALL but that functional deficiency of E47 is not a universal feature of Lmo2-induced T-ALL.
25203428 Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms.
24465765 HHEX is a direct transcriptional target of LMO2 consistent with its concordant gene expression.
24330148 LMO2 is expressed in a subset of acute myeloid leukaemia patients and is associated with normal karyotype, which is different from T lymphoblastic lymphoma/leukaemia, where specific translocation (11p13) mediates protein expression.
23897248 Staining for LMO2 in addition to CD10 and BCL6 facilitates the detection of a germinal center phenotype in follicular lymphoma
23892628 GATA2 and Lmo2 cooperatively regulate VEGF-induced angiogenesis and lymphangiogenesis via NRP2.
23812588 In t(8;21) leukemia cells, LMO2 functions as a component of the stable AML1-ETO-containing transcription factor complex (AETFC). The AETFC components cooperatively regulate gene expression and contribute to leukemogenesis.
23708655 a regulatory hierarchy of HOX control of LMO2 in normal development
23327922 Transcriptional regulators cooperate to establish or maintain primitive stem cell-like signatures in leukemic cells.
22914613 HGAL and LMO2 may be useful adjuncts in the identification of follicular lymphoma of the nongastric gastrointestinal tract.
22776842 LMO2 expression is a special feature of germinal center diffuse large B cell lymphomas.
22615488 evidence that the H3K9-me1/2 demethylase KDM3B might play a role in leukemogenesis via activation of lmo2 through interdependent actions with the histone acetyltransferase complex containing CBP
22517897 Overexpression of LMO2 in diffuse large B-cell (DLBCL) cell lines results in centrosome amplification.
22394247 The new anti-LMO2 antibody can be applied confidently to routine sections, contributing to the differential diagnosis of several lymphoma subtypes, subtyping of DLBCLs and potential development of innovative therapies.
22066713 Germline genetic variation in LMO2 was associated with diffuse large B-cell lymphoma prognosis and provided slightly stronger predictive ability relative to LMO2 immunohistochemistry status.
21722313 Data suggest that both HGAL and LMO2 are directly regulated by the transcription repressor PRDM1--overexpression of PRDM1 down-regulates HGAL and LMO2; PRDM1 directly binds to promoters of both HGAL and LMO2 and represses genetic transcription.
21670469 The measurement of a single gene expressed by tumor cells (LMO2) and a single gene expressed by the immune microenvironment (TNFRSF9) powerfully predicts overall survival in patients with diffuse large B-cell lymphoma.
21502424 LMO2 is sensitive and specific marker for detecting follicular lymphoma in nodal and extranodal sites
21459790 B-cell acute lymphoblastic leukemia cases expressed variable levels of LMO2 depending on immunophenotypical and cytogenetic features
21375434 SStudies suggest that the expression of LMO2 protein in lymphoma tissue biopsies predicts survival in patients with RA who have developed DLBCL
21076045 first structural model of the DNA-binding complex containing LMO2, LDB1, SCL/TAL1, and GATA-1
21072044 both Lmo2 and Bcl-2 are required for the action of E2A-HLF in leukemogenesis
21059912 As LMO2 controls hematopoiesis, its dysregulation is leukemogenic
21045296 Multiple-wavelength anomalous dispersion (MAD) data have been collected at the zinc X-ray absorption edge to a resolution of 2.8 A and the data were used to solve the structure of the LMO2:Ldb1-LIM-interaction domain complex.
20955387 LMO2 probably promotes angiogenesis by up-regulation of bFGF expression and thereby consequently influences progression of infantile haemangiomas
20731704 ectopically expressed LMO2 impaired the function of DeltaEF1 in both transcriptional and protein levels and identified DeltaEF1 as a novel pathogenic target of LMO2 in T-cell leukemia.
20697248 Our results show that HGAL and LMO2 are sensitive markers for follicular lymphoma diagnosis.
20686118 Overexpression of either KLF1 or LMO2 partially rescued the defect in erythropoiesis caused by c-myb silencing, whereas only KLF1 was also able to repress the megakaryocyte differentiation enhanced in Myb-silenced CD34+ cells.
20676125 a self-sustaining triad of LMO2/ERG/FLI1 stabilizes the expression of important mediators of the leukaemic phenotype such as HHEX/PRH.
20660332 The findings suggest LMO2 as a potential marker for the germinal center B-cell phenotype of diffuse large B-cell lymphoma.
20557670 We report that LMO2 protein is expressed in a significant proportion of B-ALL and AML and the staining of LMO2 protein does not predict survival in acute leukemia.
20519628 E2A-HLF promotes cell survival of t(17;19)- acute lymphoblastic leukemia cells by aberrantly up-regulating LMO2 expression
20346173 Homo-binding character of LMO2 isoforms and their synergic and antagonistic functions regulate hematopoietic-related target genes.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19671288 The abnormal expression and protein interaction of LMO2 and LYL1 may play a role in the abnormal proliferation and differentiation of myeloid hematopoietic cells.
19635185 LMO2 protein expression is correlated with improved hematologic remission and overall survival in the CML patients treated with IM.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19568416 LMO2 is a promising marker for predicting a better prognosis in pancreatic cancer.
19487290 Lmo2 is, therefore, required for sustained T-cell tumor growth, in addition to its preleukemic effect.
19336746 LMO2 is regulated at both a posttranscriptional and post-translational level in erythroid progenitors during erythropoiesis.[review]
19336552 Observational study of gene-disease association. (HuGE Navigator)
19278969 decline of miR-223 is an important event for erythroid differentiation that leads to the expansion of erythroblast cells at least partially mediated by unblocking LMO2 protein expression
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19141387 The restricted expression pattern, nuclear localization, and crisp staining of LMO2 in paraffin blocks make it an attractive candidate for the diagnostic immunohistochemistry laboratory.
19047678 GC-enriched hsa-miR-125b down-regulates the expression of IRF4 and PRDM1/BLIMP1, and memory B cell-enriched hsa-miR-223 down-regulates the expression of LMO2.
18844071 LMO2-C can bind endogenous GATA1 and LDB1 protein in K562 cells and downregulate the expression of hematopoietic specific gene glycoprotein.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18187418 LMO2, TAL1, Ttg-1, and SIL support levels of V(D)J recombination above background levels in cell culture and are also cleaved by the RAG proteins, while Hox11 and SCL are nicked but not cleaved efficiently in vitro
18079736 biallelic activation of LMO2 in immature T-ALL cases may reflect their early T-cell development stage rather than it represents a true oncogenic mechanism.
17972953 LMO2 associated with the endogenous human miR-142 promoter; LMO2 appeared to play a pivotal function in negatively regulating the expression of miR-142.
17964543 Both LMO2 and LMO4 interacted strongly to LDB1, which was required for their localization to the nucleus.
17910069 characterize the assembly of a five-component complex containing TAL1, LMO2, Ldb1, E12, and DNA. The bHLH domains of TAL1 and E12 alone primarily formed helical homodimers, but together formed heterodimers, to which LMO2 bound with high affinity
17878155 the SCL-LMO2 interaction couples protein stabilization with higher order protein complex assembly, thus providing a powerful means of modulating the stoichiometry and spatiotemporal activity of SCL complexes
17360939 critical role for the exact breakpoint location in determining LMO2 activation levels and the consequent pressure for T-ALL development.
17268520 LMO2 is most highly transcribed in CD34+ progenitor cells. Upon stimulation with growth factors typically used in gene therapy protocols transcription of LMO2.
17038524 LMO2 protein is expressed in normal germinal-center (GC) B cells and GC-derived B-cell lines and in a subset of GC-derived B-cell lymphomas, also in erythroid and myeloid precursors, megakaryocytes, and in lymphoblastic and acute myeloid leukemias.
16873670 identification of a new recurrent and cryptic deletion on chromosome 11 (del(11)(p12p13)) in about 4% (6/138) of pediatric T-ALL patients that activates the LMO2 oncogene in 4 of 6 del(11)(p12p13)-positive T-ALL patients
16793212 Therapies directed against LMO2 may be important for treatment of hemangioma because of hemangioma's limited localization and the fact that LMO2-associated protein complexes could regulate angiogenesis.
15541480 Negative regulatory elements are present in the human LMO2 oncogene and may contribute to its expression in leukemia.

AA Sequence

MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR      1 - 70
LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS     71 - 140
DIVCEQDIYEWTKINGMI                                                        141 - 158
//

Text Mined References (106)

PMID Year Title
26598604 2015 LMO2 Oncoprotein Stability in T-Cell Leukemia Requires Direct LDB1 Binding.
26161748 2015 The LMO2 -25 Region Harbours GATA2-Dependent Myeloid Enhancer and RUNX-Dependent T-Lymphoid Repressor Activity.
25721045 2015 The LIM-only transcription factor LMO2 determines tumorigenic and angiogenic traits in glioma stem cells.
25710580 De Novo Acute Myeloid Leukemia in Adults: Suppression of MicroRNA-223 is Independent of LMO2 Protein Expression BUT Associate With Adverse Cytogenetic Profile and Undifferentiated Blast Morphology.
25682596 2015 High frequency of cryptic chromosomal rearrangements involving the LMO2 gene in T-cell acute lymphoblastic leukemia.
25499232 2015 Enforced expression of E47 has differential effects on Lmo2-induced T-cell leukemias.
25416956 2014 A proteome-scale map of the human interactome network.
25203428 2015 Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms.
24465765 2014 LIM domain only-2 (LMO2) induces T-cell leukemia by two distinct pathways.
24379077 2014 LIM-domain-only proteins: multifunctional nuclear transcription coregulators that interacts with diverse proteins.
24330148 2014 LMO2 (LIM domain only 2) is expressed in a subset of acute myeloid leukaemia and correlates with normal karyotype.
23897248 2013 Immunoarchitectural patterns of germinal center antigens including LMO2 assist in the differential diagnosis of marginal zone lymphoma vs follicular lymphoma.
23892628 2013 GATA2 and Lmo2 control angiogenesis and lymphangiogenesis via direct transcriptional regulation of neuropilin-2.
23812588 2013 A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis.
23708655 2013 HOX-mediated LMO2 expression in embryonic mesoderm is recapitulated in acute leukaemias.
23327922 2013 Activity of a heptad of transcription factors is associated with stem cell programs and clinical outcome in acute myeloid leukemia.
22914613 2013 Usefulness of HGAL and LMO2 immunohistochemistry in the identification of follicular lymphomas of the non-gastric gastrointestinal tract.
22776842 2011 High expression of LMO2 in Hodgkin, Burkitt and germinal center diffuse large B cell lymphomas.
22615488 2012 KDM3B is the H3K9 demethylase involved in transcriptional activation of lmo2 in leukemia.
22517897 2012 Identification of LMO2 transcriptome and interactome in diffuse large B-cell lymphoma.
22394247 2012 Detection of LIM domain only 2 (LMO2) in normal human tissues and haematopoietic and non-haematopoietic tumours using a newly developed rabbit monoclonal antibody.
22066713 2012 LIM domain only 2 protein expression, LMO2 germline genetic variation, and overall survival in diffuse large B-cell lymphoma in the pre-rituximab era.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21722313 2011 PRDM1/Blimp1 downregulates expression of germinal center genes LMO2 and HGAL.
21670469 2011 Prediction of survival in diffuse large B-cell lymphoma based on the expression of 2 genes reflecting tumor and microenvironment.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21502424 2011 The efficacy of HGAL and LMO2 in the separation of lymphomas derived from small B cells in nodal and extranodal sites, including the bone marrow.
21459790 2011 LMO2 expression reflects the different stages of blast maturation and genetic features in B-cell acute lymphoblastic leukemia and predicts clinical outcome.
21375434 2011 LMO2 protein expression predicts survival in patients with rheumatoid arthritis and diffuse large B-cell lymphoma.
21076045 2011 Structure of the leukemia oncogene LMO2: implications for the assembly of a hematopoietic transcription factor complex.
21072044 2011 The E2A-HLF oncogenic fusion protein acts through Lmo2 and Bcl-2 to immortalize hematopoietic progenitors.
21059912 2010 Building multifunctionality into a complex containing master regulators of hematopoiesis.
21045296 2010 Purification, crystallization and preliminary X-ray analysis of a fusion of the LIM domains of LMO2 and the LID domain of Ldb1.
20955387 2010 LMO2 promotes angiogenesis probably by up-regulation of bFGF in endothelial cells: an implication of its pathophysiological role in infantile haemangioma.
20731704 2010 Identification of DeltaEF1 as a novel target that is negatively regulated by LMO2 in T-cell leukemia.
20697248 2010 Immunoarchitectural patterns in follicular lymphoma: efficacy of HGAL and LMO2 in the detection of the interfollicular and diffuse components.
20686118 2010 c-myb supports erythropoiesis through the transactivation of KLF1 and LMO2 expression.
20676125 2010 A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients.
20660332 2010 Expression of LMO2 is associated with t(14;18)/IGH-BCL2 fusion but not BCL6 translocations in diffuse large B-cell lymphoma.
20557670 2010 The expression of LMO2 protein in acute B-cell and myeloid leukemia.
20519628 2010 Aberrant induction of LMO2 by the E2A-HLF chimeric transcription factor and its implication in leukemogenesis of B-precursor ALL with t(17;19).
20346173 2010 Homo-binding character of LMO2 isoforms and their both synergic and antagonistic functions in regulating hematopoietic-related target genes.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19671288 2009 [Abnormal expression of transcription factors LYL1 and LMO2 and interaction between them in myeloid leukemia].
19635185 2009 Effect of LMO2 protein expression on survival in chronic myeloid leukemia patients treated with imatinib mesylate.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19568416 2009 LMO2 is a novel predictive marker for a better prognosis in pancreatic cancer.
19487290 2009 Targeting LMO2 with a peptide aptamer establishes a necessary function in overt T-cell neoplasia.
19375645 2009 GAR22: a novel target gene of thyroid hormone receptor causes growth inhibition in human erythroid cells.
19336746 2009 Regulation of LMO2 mRNA and protein expression in erythroid differentiation.
19336552 2009 Risk of non-Hodgkin lymphoma associated with germline variation in genes that regulate the cell cycle, apoptosis, and lymphocyte development.
19278969 2009 MicroRNA 223-dependent expression of LMO2 regulates normal erythropoiesis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19141387 2009 The transcription factor LMO2 is a robust marker of vascular endothelium and vascular neoplasms and selected other entities.
19047678 2009 Differentiation stage-specific expression of microRNAs in B lymphocytes and diffuse large B-cell lymphomas.
18844071 2008 [Identification of interaction partners and function analysis of new splicing product of human LMO2 gene].
18763096 2001 A novel post-transcriptional splicing form of the acute T cell leukemia proto-oncogene Lmo2.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18187418 2008 V(D)J recombinase binding and cleavage of cryptic recombination signal sequences identified from lymphoid malignancies.
18079736 2008 Monoallelic or biallelic LMO2 expression in relation to the LMO2 rearrangement status in pediatric T-cell acute lymphoblastic leukemia.
17972953 2008 Downregulation of microRNA-142 by proto-oncogene LMO2 and its co-factors.
17964543 2007 The Lim-only protein LMO2 acts as a positive regulator of erythroid differentiation.
17910069 2008 Assembly of the oncogenic DNA-binding complex LMO2-Ldb1-TAL1-E12.
17878155 2007 Protein stability and transcription factor complex assembly determined by the SCL-LMO2 interaction.
17360939 2007 Different chromosomal breakpoints impact the level of LMO2 expression in T-ALL.
17268520 2007 Ectopic retroviral expression of LMO2, but not IL2Rgamma, blocks human T-cell development from CD34+ cells: implications for leukemogenesis in gene therapy.
17038524 2007 The oncoprotein LMO2 is expressed in normal germinal-center B cells and in human B-cell lymphomas.
16873670 2006 The cryptic chromosomal deletion del(11)(p12p13) as a new activation mechanism of LMO2 in pediatric T-cell acute lymphoblastic leukemia.
16793212 2006 A postulated role for transcriptional regulator LMO2 in the proliferation and involution of hemangioma.
16314316 2005 Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15541480 2005 Negative regulatory elements are present in the human LMO2 oncogene and may contribute to its expression in leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878195 2003 The LIM-only protein LMO4 modulates the transcriptional activity of HEN1.
12727888 2003 Structural basis for the recognition of ldb1 by the N-terminal LIM domains of LMO2 and LMO4.
12609830 2003 A PAR domain transcription factor is involved in the expression from a hematopoietic-specific promoter for the human LMO2 gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12067721 2002 The LIM domain protein Lmo2 binds to AF6, a translocation partner of the MLL oncogene.
11882901 2002 Ubiquitination-dependent cofactor exchange on LIM homeodomain transcription factors.
11751867 2002 The LIM domain protein LMO4 interacts with the cofactor CtIP and the tumor suppressor BRCA1 and inhibits BRCA1 activity.
11069036 2000 Identification of genes potentially involved in LMO2-induced leukemogenesis.
10866689 2000 A pentamer transcriptional complex including tal-1 and retinoblastoma protein downmodulates c-kit expression in normal erythroblasts.
10431247 1999 RLIM inhibits functional activity of LIM homeodomain transcription factors via recruitment of the histone deacetylase complex.
9819382 1998 TAL1 and LIM-only proteins synergistically induce retinaldehyde dehydrogenase 2 expression in T-cell acute lymphoblastic leukemia by acting as cofactors for GATA3.
9736723 1998 Identification and characterization of LMO4, an LMO gene with a novel pattern of expression during embryogenesis.
9452425 1998 The nuclear LIM domain interactor NLI mediates homo- and heterodimerization of LIM domain transcription factors.
9391090 1997 The LIM-domain binding protein Ldb1 and its partner LMO2 act as negative regulators of erythroid differentiation.
9214632 1997 The LIM-only protein Lmo2 is a bridging molecule assembling an erythroid, DNA-binding complex which includes the TAL1, E47, GATA-1 and Ldb1/NLI proteins.
9209374 1997 LIM-only protein Lmo2 forms a protein complex with erythroid transcription factor GATA-1.
9129143 1997 T-cell oncogene rhombotin-2 interacts with retinoblastoma-binding protein 2.
9001422 1997 Elf-2, a rhombotin-2 binding ets transcription factor: discovery and potential role in T cell leukemia.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8078932 1994 The LIM protein RBTN2 and the basic helix-loop-helix protein TAL1 are present in a complex in erythroid cells.
7957052 1994 Specific in vivo association between the bHLH and LIM proteins implicated in human T cell leukemia.
7731680 1995 Functional diversity of LIM proteins: amino-terminal activation domains in the oncogenic proteins RBTN1 and RBTN2.
7568177 1995 Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1.
7475267 1995 Molecular characterization of a chromosome translocation breakpoint t(11;14)(p13;q11) from the cell line KOPT-K1.
2052354 1991 Developmentally regulated and tissue specific expression of mRNAs encoding the two alternative forms of the LIM domain oncogene rhombotin: evidence for thymus expression.
2034676 1991 The rhombotin family of cysteine-rich LIM-domain oncogenes: distinct members are involved in T-cell translocations to human chromosomes 11p15 and 11p13.
1923511 1991 TTG-2, a new gene encoding a cysteine-rich protein with the LIM motif, is overexpressed in acute T-cell leukaemia with the t(11;14)(p13;q11).