Property Summary

NCBI Gene PubMed Count 43
PubMed Score 38.97
PubTator Score 28.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy -1.037 3.2e-06
cutaneous lupus erythematosus -1.100 3.2e-03
group 3 medulloblastoma 1.900 5.0e-03
medulloblastoma, large-cell 1.200 2.1e-02
primitive neuroectodermal tumor 2.100 6.0e-04

Gene RIF (15)

AA Sequence

MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKAN      1 - 70
LILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQM     71 - 140
DYEEGQLNGTFESQVQ                                                          141 - 156
//

Text Mined References (44)

PMID Year Title