Property Summary

NCBI Gene PubMed Count 4
PubMed Score 239.90
PubTator Score 152.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.661 4.5e-05
sonic hedgehog group medulloblastoma -1.700 1.5e-05
medulloblastoma, large-cell -1.100 5.3e-03
pancreatic ductal adenocarcinoma liver m... 1.273 7.9e-04
Breast cancer 2.200 4.3e-02

Gene RIF (2)

PMID Text
19706689 Immunofluorescent detection of human invadolysin in cultured cells reveals the protein to be associated with the surface of lipid droplets.
15557119 Functional characterization of a similar protein in Drosophila and comparative studies with the human protein.

AA Sequence

MVTTLGPKMAAEWGGGVGYSGSGPGRSRWRWSGSVWVRSVLLLLGGLRASATSTPVSLGSSPPCRHHVPS      1 - 70
DTEVINKVHLKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTI     71 - 140
LLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDAD    141 - 210
FVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGF    211 - 280
SAGLFAFYHDKDGNPLTSRFADGLPPFNYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVE    281 - 350
EARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGRQMLSPYCD    351 - 420
TLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWH    421 - 490
LSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGL    491 - 560
KVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWDFCELCPPETDPPATNLTRALPLDLCSCSSS    561 - 630
LVVTLWLLLGNLFPLLAGFLLCIWH                                                 631 - 655
//

Text Mined References (5)

PMID Year Title
19706689 2009 The conserved metalloprotease invadolysin localizes to the surface of lipid droplets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15557119 2004 Invadolysin: a novel, conserved metalloprotease links mitotic structural rearrangements with cell migration.