Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.11
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Gene RIF (2)

PMID Text
21996735 Together, our results suggest that LMCD1 mutations are potential oncogenic events in HCC metastasis to promote cell migration through the Rac1-signaling pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIG      1 - 70
RLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKE     71 - 140
KQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKE    141 - 210
EGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSE    211 - 280
PLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVT    281 - 350
KGQLLCPTCSKSKRS                                                           351 - 365
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21996735 2012 Somatic LMCD1 mutations promoted cell migration and tumor metastasis in hepatocellular carcinoma.
21629665 2011 Sphingosine 1-phosphate induces differentiation of mesoangioblasts towards smooth muscle. A role for GATA6.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20026769 2010 LIM and cysteine-rich domains 1 regulates cardiac hypertrophy by targeting calcineurin/nuclear factor of activated T cells signaling.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16199866 2005 LMCD1/Dyxin is a novel transcriptional cofactor that restricts GATA6 function by inhibiting DNA binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10662546 2000 Identification of a novel LIM domain gene, LMCD1, and chromosomal localization in human and mouse.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.