Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.69
PubTator Score 6.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 3.0e-07
Disease Target Count Z-score Confidence
Ocular hypertension 27 3.259 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -2.100 3.0e-07

Gene RIF (4)

PMID Text
23964685 LIMR was shown to be highly specific for Lcn1, binding the lipocalin with low micromolar to high nanomolar affinity
21791187 The receptor to which lipocalin binds is termed tear lipocalin-interacting membrane receptor and it appears to work by endocytosis.
17991420 Human LIMR, known to act as an endocytic receptor for lipocalin-1, also binds bovine BLG and mediates its cellular uptake.
12591932 LIMR mediating internalization of lipocalin-1 (Lcn-1) in NT2 cells, leading to its degradation.

AA Sequence

MEAPDYEVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDDEDATVNKIALELCTF      1 - 70
TLAIALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGF     71 - 140
AGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDKNKANRESLYDFWEYYLPYLYSCISFLGVLLLL    141 - 210
VCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQTQ    211 - 280
RVLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGS    281 - 350
FGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDL    351 - 420
LGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQHQ     421 - 489
//

Text Mined References (16)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
23964685 Expression, characterization and ligand specificity of lipocalin-1 interacting membrane receptor (LIMR).
21791187 2011 Tear lipocalin: structure and function.
20446115 2011 LMBRD1: the gene for the cblF defect of vitamin B?? metabolism.
19136951 2009 Identification of a putative lysosomal cobalamin exporter altered in the cblF defect of vitamin B12 metabolism.
17991420 2008 Lipocalin-interacting-membrane-receptor (LIMR) mediates cellular internalization of beta-lactoglobulin.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16423471 2006 Interaction of uteroglobin with lipocalin-1 receptor suppresses cancer cell motility and invasion.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12591932 2003 Antisense down-regulation of lipocalin-interacting membrane receptor expression inhibits cellular internalization of lipocalin-1 in human NT2 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11287427 2001 Molecular cloning of a novel lipocalin-1 interacting human cell membrane receptor using phage display.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.