Property Summary

NCBI Gene PubMed Count 25
PubMed Score 1151.09
PubTator Score 24.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.015 1.5e-02
psoriasis 2.400 4.1e-05
osteosarcoma 4.435 8.4e-10
medulloblastoma, large-cell -1.200 3.8e-03
group 3 medulloblastoma -1.300 3.1e-03
posterior fossa group B ependymoma 1.100 1.7e-04
non primary Sjogren syndrome sicca 1.100 2.2e-02
ovarian cancer 1.700 3.3e-10

Gene RIF (17)

PMID Text
26662669 Reduced expression of Hugl 1 predicts poor survival in lung SqCC patients. The expression of Hugl 1 was inversely correlated with both overall survival rate and tumor stage.
26341367 this study provides the evidence that Hugl-1 inhibits glioma cell growth in intracranial model of nude mice, suggesting that Hugl-1 might be a potential tumor target for glioma therapy.
25982280 Our results support the growing appreciation that the tumour regulatory functions of Scribble, and other polarity protein family members, are context dependent.
25426552 Lgl1 has a role in inhibiting glioblastoma
23907540 PTEN loss leads to the phosphorylation and inactivation of Lgl by atypical protein kinase C in glioblastoma cells.
23864775 Suggest that Hugl-1 induces growth suppression and apoptosis in a human esophageal squamous cell carcinoma cell line both in vitro and in vivo.
23277453 inactivation of Llgl1 enhances hematopoietic stem cells self-renewal and fitness and is associated with unfavorable outcome in human acute myeloid leukemia
23110097 Hugl1 and Hugl2 play an essential role in the maintenance of breast epithelial polarity and differentiated cell morphology, as well as growth control.
22843887 Preservation of HUGL-1 expression in pancreatic adenocarcinoma is a good prognostic factor that contributes to a better overall survival
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19447873 Results provide the first evidence that Hugl-1 mRNA is frequently mutated by aberrant splicing exclusively in HCC, which may be involved in HCC progression.
18074678 loss of Hugl-1 expression in endometrial cancer may contribute to lymph node metastasis and it can be a factor of poor prognosis.
17369850 aPKCzeta cortical loading is associated with Lgl cytoplasmic release and tumor growth in Drosophila and human epithelia
16170365 loss of Hugl-1 expression contributes to melanoma progression
15735678 downregulation of Hugl-1 contributes to colorectal cancer progression
15467749 Hugl-1 can act as a tumour suppressor in Drosophila and thus is the functional homologue of lgl

AA Sequence

MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTG      1 - 70
LHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVT     71 - 140
VVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTK    141 - 210
ILIGYSRGLLVIWNQASQCVDHIFLGNQQLESLCWGRDSSTVVSSHSDGSYAVWSVDAGSFPTLQPTVAT    211 - 280
TPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRIIDFFTVHSTR    281 - 350
PEDEFDDPQALAVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQS    351 - 420
PQPVSSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQTDCEHADSLA    421 - 490
QAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQMVVAGTAGQVLVLELSDVPVEQAVSVAIIDLL    491 - 560
QDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLFDYQRKS    561 - 630
PVLARCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHD    631 - 700
VEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDGAHHGPTMWAGTNSGSVFAYALEVPAAAVGGEKRP    701 - 770
EQAVEAVLGKEVQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPK    771 - 840
VSAKTKFKLTAHEGCRVRKVALATFASVACEDYAETCLACLTNLGDVHVFSVPGLRPQVHYSCIRKEDIS    841 - 910
GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSIL    911 - 980
LAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRN    981 - 1050
LAEDEAHACAILIK                                                           1051 - 1064
//

Text Mined References (27)

PMID Year Title
26662669 2015 Reduced Expression of Hugl 1 Contributes to the Progression of Lung Squamous Cell Carcinoma.
26341367 2015 Hugl-1 inhibits glioma cell growth in intracranial model.
25982280 2016 Scribble acts as an oncogene in E?-myc-driven lymphoma.
25426552 2014 Inhibition of glioblastoma malignancy by Lgl1.
23907540 2013 PTEN loss represses glioblastoma tumor initiating cell differentiation via inactivation of Lgl1.
23864775 2013 Hugl-1 induces apoptosis in esophageal carcinoma cells both in vitro and in vivo.
23277453 2013 The cell fate determinant Llgl1 influences HSC fitness and prognosis in AML.
23110097 2012 Hugl1 and Hugl2 in mammary epithelial cells: polarity, proliferation, and differentiation.
22843887 2012 Preservation of HUGL-1 expression as a favourable prognostic factor in pancreatic carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20644714 2010 Involvement of Lgl and Mahjong/VprBP in cell competition.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19447873 2009 Aberrant splicing of Hugl-1 is associated with hepatocellular carcinoma progression.
18074678 2007 Loss of Hugl-1 expression associates with lymph node metastasis in endometrial cancer.
17369850 2007 aPKCzeta cortical loading is associated with Lgl cytoplasmic release and tumor growth in Drosophila and human epithelia.
16170365 2006 Expression of Hugl-1 is strongly reduced in malignant melanoma.
15735678 2005 Reduced expression of Hugl-1, the human homologue of Drosophila tumour suppressor gene lgl, contributes to progression of colorectal cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467749 2004 The human protein Hugl-1 substitutes for Drosophila lethal giant larvae tumour suppressor function in vivo.
12725730 2003 Mammalian Lgl forms a protein complex with PAR-6 and aPKC independently of PAR-3 to regulate epithelial cell polarity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
11714708 2002 A functional interaction between CD46 and DLG4: a role for DLG4 in epithelial polarization.
9177775 1997 Genomic structure, evolution, and expression of human FLII, a gelsolin and leucine-rich-repeat family member: overlap with LLGL.
8565641 1996 The human homologue of the murine Llglh gene (LLGL) maps within the Smith-Magenis syndrome region in 17p11.2.
7542763 1995 A human homologue of the Drosophila tumour suppressor gene l(2)gl maps to 17p11.2-12 and codes for a cytoskeletal protein that associates with nonmuscle myosin II heavy chain.