Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.9e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.400 2.9e-05

AA Sequence

MPPPAKEGGRKGPRERSGKSAPGTAQGEERAKGAPATEPPKPGWALTPQGLAAMLPAQRHRHLLFGDLLE      1 - 70
DVGAAASTFPCGSVEPGYRMPDPRPWTQSLELPAERQNRLLGVLKAAEARGRVRALRLRYTRMRAEEIAL     71 - 140
LIQRQKSARAAIRLELFLPPQLKPARIPDPLDRQERRRVETILEENVDGTIFPR                    141 - 194
//

Text Mined References (4)

PMID Year Title