Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.62
PubTator Score 0.18

Knowledge Summary

Patent

No data available

Synonym

Accession Q8IVB5 Q6AI36
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (1)

PMID Text
26310847 LIX1L is an RNA-binding protein, with implications for therapeutic approaches for targeting LIX1L in LIX1L-expressing cancer cells.

AA Sequence

METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGA      1 - 70
AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYVCYV     71 - 140
TLPGGSCFGSFQFCPTKAEARRSAAKIALMNSVFNEHPSRRITDEFIEKSVSEALASFNGNREEADNPNT    141 - 210
GIGAFRFMLESNKGKSMLEFQELMTVFQLLHWNGSLKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDW    211 - 280
VSREQSVPGALSRELASTERELDEARLAGKELRFHKEKKDILVLAAGQLGNMHSSNC                 281 - 337
//

Text Mined References (5)

PMID Year Title
26310847 2015 Novel roles for LIX1L in promoting cancer cell proliferation through ROS1-mediated LIX1L phosphorylation.
19710173 2009 Drosophila lowfat, a novel modulator of Fat signaling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.