Property Summary

Ligand Count 346
NCBI Gene PubMed Count 119
PubMed Score 192.19
PubTator Score 154.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 CSPA Cell Line (2)

Gene RIF (104)

AA Sequence

MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGH      1 - 70
SQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRV     71 - 140
VGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSP    141 - 210
DDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHL    211 - 280
FVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ    281 - 350
MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS    351 - 420
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMK    421 - 490
NETSPTVELP                                                                491 - 500
//

Text Mined References (120)

PMID Year Title