Property Summary

NCBI Gene PubMed Count 36
PubMed Score 46.12
PubTator Score 186.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Obesity 655
Disease Target Count P-value
posterior fossa group B ependymoma 406 1.3e-06
Disease Target Count Z-score Confidence
Wolman disease 6 5.668 2.8
Cholesterol ester storage disease 6 4.605 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.600 1.3e-06

Gene RIF (15)

AA Sequence

MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKN      1 - 70
SGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAF     71 - 140
SFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSL    141 - 210
INKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLS    211 - 280
HNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD    281 - 350
VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK                          351 - 398
//

Text Mined References (39)

PMID Year Title