Property Summary

NCBI Gene PubMed Count 48
PubMed Score 94.32
PubTator Score 93.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.200 1.5e-09
glioblastoma -2.500 3.0e-03
ependymoma -1.400 4.3e-04
medulloblastoma -2.500 4.6e-08
atypical teratoid / rhabdoid tumor -2.600 1.6e-07
medulloblastoma, large-cell -2.300 5.2e-03
pediatric high grade glioma -1.900 2.5e-03
inflammatory breast cancer 1.100 3.7e-02
invasive ductal carcinoma 1.200 1.3e-02

Gene RIF (50)

PMID Text
26979953 LINGO1 protein acts as a gateway protein internalizing into the tumor cells when engaged by antibody and can carry antibody conjugated with drugs to kill Ewing sarcoma cells.
26254004 LINGO1 rs11856808 plays a protective role by decreasing the risk for PD, but not for MSA, in Chinese population.
25666623 Data indicate that leucine-rich repeat neuronal protein 1 (LINGO-1) is intracellular and competes with Nogo-66 receptor (NgR) for binding to p75 neurotrophin receptor (p75NTR).
24583087 LINGO-1 can directly bind to ErbB2, block ErbB2 translocation into lipid rafts, and inhibit its phosphorylation.
24531928 The results of this study show Increased LINGO1 in the cerebellum of essential tremor patients.
24448210 Lingo-1 signaling is altered in the schizophrenia brain.
23754655 LINGO1 variants are associated with essential tremor in Chinese Han female patients.
23682623 This review found that several gene variants in the LINGO1 gene may increase the risk of essential tremor.
23574883 This study demonistrated that theLINGO1 rs9652490 and rs11856808 polymorphisms are not associated with risk for multiple sclerosis.
23482566 LINGO-1 potentiates neuronal apoptosis, likely by inhibiting WNK3 kinase activity.
22710005 the present meta-analysis does not support the notion that LINGO1 rs9652490 SNP is a major genetic risk factor for parkinson disease.[meta-analysis]
22514275 LINGO-1, a transmembrane signaling protein, inhibits oligodendrocyte differentiation and myelination through intercellular self-interactions
22425540 Results of a meta-analysis suggest a relationship between LINGO1 rs11856808 polymorphism and risk of essential tremor (ET) and familial ET, while rs9652490 polymorphism is only associated with the risk for familial ET.
22133804 the N-terminal region containing the leucine-rich repeats along with the transmembrane and cytoplasmic domains of LINGO-1 are not required for self-interaction or interaction with amyloid precursor protein
21955595 This study showed that LINGO1 rs9652490 and rs11856808 are not associated with the risk of Parkinson's disease.
21752692 Single nucleotide polymorphism(SNP)s of LINGO1 play a role in the development of Parkinson's disease in the Italian population.
21741293 There were no significant differences in frequencies for all alleles between the essential tremor (ET) group and controls; however, an association of genotype A/G of the SNP rs9652490 with the familial ET phenotype was found.
21506150 This study demonistrated that LINGO1 variants could increase risk of PD, specifically those presenting the non-rigid-akinetic phenotypes, which suggests that LINGO1 may have a role in the etiology of tremor in PD at least in the Spanish population.
21264305 genotyping results lead us to conclude that no association exists between the key variant rs9652490 and Essential tremor (P(corr) = 1.00).
21219542 LINGO1 variants are not a major risk factor for developing familial essential tremor in this population, which suggests the existence of other genetic risk factors responsible for familial essential tremor in this movement disorder clinic population.
21158743 while there were no significant differences in the Lingo1 minor allele frequency and genotype frequency between Chinese essential tremor and controls, pooled analysis showed a higher proportion of GG genotype in tremor patients
20957646 LINGO1 variant rs9652490 (A > G) is unlikely to play a major role in Parkinson's disease in Chinese populations.
20951767 No significant differences are found in genotype and allele distribution in the rs9652490 variant of LINGO1 in either Chinese or Caucasian Parkinson disease patients.
20951767 Observational study of gene-disease association. (HuGE Navigator)
20659559 LINGO-1 inhibits multiple aspects of oligodendrocyte differentiation independently of the LRRs via a process that requires p75(NTR) signalling
20600614 The two markers rs9652490 and rs11856808 were not strongly related to the essential tremor,late onset sporadic Parkinson's disease, but the rs9652490G allele might be a protective factor for the early onset Parkinson's disease in Chinese population.
20600614 Observational study of gene-disease association. (HuGE Navigator)
20468067 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20372186 The LINGO1 gene is a risk factor for essential tremor in a Caucasian population in North America.
20372186 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20369371 LINGO1 and LINGO2 variants are associated with essential tremor and Parkinson disease
20369371 Observational study of gene-disease association. (HuGE Navigator)
20310002 Our study gives further evidence that LINGO1 acts as a susceptibility gene for essential tremor.
20310002 Observational study of gene-disease association. (HuGE Navigator)
20117178 LINGO1 SNP (rs9652490) is not associated with sporadic PD in our Polish cohort.
20117178 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19908305 In this study, SNPs rs9652490, rs11856808, and rs7177008 of LINGO1 were genotyped in a total of 694 Austrian subjects (349 PD, 345 controls). No association could be found between genotype or allele counts and Parkinson disease.
19908305 Observational study of gene-disease association. (HuGE Navigator)
19805735 LINGO1 variant increases risk of familial essential tremor.
19720553 Thisdy demonstrateda significant association between LINGO1 rs9652490 and essential tremor (P = 0.014) and Parkinson disease (P = 0.0003), thus providing the first evidence of a genetic link between both diseases.
19720553 Observational study of gene-disease association. (HuGE Navigator)
19553813 the LINGO1 gene is associated with an increased risk for essential tremor
19363035 WNK1 is a novel signaling molecule involved in regulation of LINGO-1 mediated inhibition of neurite extension.
19254717 Quick identification of essential N-glycosylation sites of a heavily glycosylated neuroglycoprotein Lingo-1, which are sufficient for the support of its surface expression.
19182806 Variant in the sequence of the LINGO1 gene confers risk of essential tremor.
19182806 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17726113 inhibitory agents of LINGO-1 activity can protect dopaminergic neurons against degeneration
17239012 the ternary complex of NgR/TROY/LINGO-1 expressed on astrocytes, macrophages/microglia and neurones, by interacting with Nogo-A on oligodendrocytes, might modulate glial-neuronal interactions in demyelinating lesions of multiple sclerosis
17005555 the Lingo-1 ectodomain is a module implicated in central nervous system repair inhibition
14686891 The LERN1 expression pattern is specific to the central nervous system, highly and broadly expressed during early stages of development and gradually restricted to forebrain structures as development proceeds(LERN1)

AA Sequence

MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIP      1 - 70
TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFT     71 - 140
GLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEA    141 - 210
LSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPY    211 - 280
LAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTL    281 - 350
EESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT    351 - 420
CRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQ    421 - 490
DNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKTLIIA    491 - 560
TTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSADAPRKFNMKMI              561 - 620
//

Text Mined References (52)

PMID Year Title
26979953 2016 Exploring the surfaceome of Ewing sarcoma identifies a new and unique therapeutic target.
26254004 2015 Analysis and meta-analysis of five polymorphisms of the LINGO1 and LINGO2 genes in Parkinson's disease and multiple system atrophy in a Chinese population.
25666623 2015 LINGO-1 protein interacts with the p75 neurotrophin receptor in intracellular membrane compartments.
25416956 2014 A proteome-scale map of the human interactome network.
24583087 2014 LINGO-1 regulates oligodendrocyte differentiation by inhibiting ErbB2 translocation and activation in lipid rafts.
24531928 2014 Increased LINGO1 in the cerebellum of essential tremor patients.
24448210 2014 Novel implications of Lingo-1 and its signaling partners in schizophrenia.
23754655 2013 Genetic analysis of the leucine-rich repeat and lg domain containing Nogo receptor-interacting protein 1 gene in essential tremor.
23682623 2013 Update on genetics of essential tremor.
23574883 2013 LINGO1 rs9652490 and rs11856808 polymorphisms are not associated with risk for multiple sclerosis.
23482566 2013 LINGO-1 receptor promotes neuronal apoptosis by inhibiting WNK3 kinase activity.
22710005 2012 Genetic variation in LINGO-1 (rs9652490) and risk of Parkinson's disease: twelve studies and a meta-analysis.
22514275 2012 LINGO-1, a transmembrane signaling protein, inhibits oligodendrocyte differentiation and myelination through intercellular self-interactions.
22425540 2012 LINGO1 and risk for essential tremor: results of a meta-analysis of rs9652490 and rs11856808.
22216198 2011 A genome-wide association study of the Protein C anticoagulant pathway.
22133804 2012 The leucine-rich repeats of LINGO-1 are not required for self-interaction or interaction with the amyloid precursor protein.
21955595 2012 LINGO1 rs9652490 and rs11856808 are not associated with the risk of Parkinson's disease: results of a meta-analysis.
21752692 2011 Association study between the LINGO1 gene and Parkinson's disease in the Italian population.
21741293 2012 Screening of 10 SNPs of LINGO1 gene in patients with essential tremor in the Latvian population.
21506150 2011 LINGO1 gene analysis in Parkinson's disease phenotypes.
21264305 2011 LINGO1 variants in the French-Canadian population.
21219542 2011 Lack of association of LINGO1 rs9652490 and rs11856808 SNPs with familial essential tremor.
21158743 2011 Analysis of Lingo1 variant in sporadic and familial essential tremor among Asians.
20957646 2011 Genetic analysis of "leucine-rich repeat (LRR) and immunoglobulin (Ig) domain-containing, Nogo receptor-interacting protein-1 (LINGO1)" in two independent Chinese parkinson's disease populations.
20951767 2011 LINGO1 rs9652490 variant in Parkinson disease patients.
20659559 2010 LINGO-1-mediated inhibition of oligodendrocyte differentiation does not require the leucine-rich repeats and is reversed by p75(NTR) antagonists.
20600614 2010 Screening for two SNPs of LINGO1 gene in patients with essential tremor or sporadic Parkinson's disease in Chinese population.
20468067 2010 LINGO1 is not associated with Parkinson's disease in German patients.
20372186 2010 Replication of the LINGO1 gene association with essential tremor in a North American population.
20369371 2010 LINGO1 and LINGO2 variants are associated with essential tremor and Parkinson disease.
20310002 2010 LINGO1 polymorphisms are associated with essential tremor in Europeans.
20117178 2010 Analysis of LINGO1 (rs9652490) polymorphism in sporadic Parkinson's disease in a Polish population, and a meta-analysis.
19908305 2009 Role of LINGO1 polymorphisms in Parkinson's disease.
19805735 2009 LINGO1 variant increases risk of familial essential tremor.
19720553 2010 LINGO1 rs9652490 is associated with essential tremor and Parkinson disease.
19553813 2009 Tremor.
19363035 2009 LINGO-1 interacts with WNK1 to regulate nogo-induced inhibition of neurite extension.
19254717 2009 Swift residue-screening identifies key N-glycosylated asparagines sufficient for surface expression of neuroglycoprotein Lingo-1.
19182806 2009 Variant in the sequence of the LINGO1 gene confers risk of essential tremor.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17726113 2007 Inhibition of the leucine-rich repeat protein LINGO-1 enhances survival, structure, and function of dopaminergic neurons in Parkinson's disease models.
17239012 2007 TROY and LINGO-1 expression in astrocytes and macrophages/microglia in multiple sclerosis lesions.
17005555 2006 The structure of the Lingo-1 ectodomain, a module implicated in central nervous system repair inhibition.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15895088 2005 LINGO-1 negatively regulates myelination by oligodendrocytes.
15694321 2005 A TNF receptor family member, TROY, is a coreceptor with Nogo receptor in mediating the inhibitory activity of myelin inhibitors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966521 2004 LINGO-1 is a component of the Nogo-66 receptor/p75 signaling complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14686891 2003 LRRN6A/LERN1 (leucine-rich repeat neuronal protein 1), a novel gene with enriched expression in limbic system and neocortex.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.