Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A4QN01 A6NCD0
Symbols C10orf40

 Compartment GO Term (1)

AA Sequence

MKHKYNTLSWYKKERSTQLRRFIVHQPEVGLFFFLRDVVYNYITEKTTCRCPLTQERPCDTGGKFGRIWI      1 - 70
CQPEELGKMQIWICQPEELGKMQIDKNRTMVQQMWYIWYGGLDTSTNSLLPILVRGMA                 71 - 128
//

Text Mined References (3)

PMID Year Title