Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZRV3
Symbols C3orf74

 Compartment GO Term (0)

AA Sequence

MQSVDSMLGTVGGCGGGEAASTFSKDPSGCCVGNDCRDGGRGLERRHGRWSRGEGGESGLCSGGQMASEI      1 - 70
EYWDGLAISVMEVEKAFGSTNVLWKTEPFSLWACTAACPPSLSPTLLALGLPRDGKELAEQGSLWTVLEP     71 - 140
GGDWSHSQSQLGTPGRGKGALGF                                                   141 - 163
//

Text Mined References (2)

PMID Year Title