Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma -1.900 2.1e-08
atypical teratoid / rhabdoid tumor -1.600 5.5e-07
lung carcinoma 4.000 1.4e-52
pituitary cancer -3.100 8.3e-05
psoriasis -1.400 8.2e-18

Synonym

Accession Q86TS7
Symbols

 Compartment GO Term (0)

AA Sequence

MVQECCSQSLYYEELHSYHIVPYASENAIYEMGYTSSHLEQNSQLLIYKMN                         1 - 51
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.