Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.08
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.2e-07
Disease Target Count Z-score Confidence
Newcastle disease 14 4.08 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.100 1.2e-07

Gene RIF (1)

AA Sequence

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRL      1 - 70
VAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSIS     71 - 140
RMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK                141 - 198
//

Text Mined References (16)

PMID Year Title