Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.6e-07
psoriasis 6685 2.1e-03


  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.385 1.6e-07
psoriasis -1.500 2.1e-03


Accession Q86TU6 A2RUP4
Symbols C14orf70

 Compartment GO Term (0)

AA Sequence

SKQNLKDEEKLRYIKTGKSIQVEGTVRAKALRWVQ                                        71 - 105

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.