Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.6e-10
ovarian cancer 8520 5.2e-04

Expression

  Differential Expression (2)

Disease log2 FC p
juvenile dermatomyositis -1.001 1.6e-10
ovarian cancer -1.300 5.2e-04

Synonym

Accession Q8N8I6
Symbols C17orf55

 Compartment GO Term (0)

AA Sequence

MPRSLKRAQLRSLLPRPPAVSHTQPWYRAAHPTTSPTAASRDVHPASGAVPGPWLVEGTAVREGPQLQDA      1 - 70
VPQRPTRPSKALWPAQMSAAPAIRLGQMVPGDTRGLWGPQGTLLTWTYRGGQGGRWTRRAEGPREGTFAE     71 - 140
QRPHFQSSGAQQESRLAMGPPPLGLGDAAGDGRGQTGQEKGRAEGRQARKSACKCPRKGPNPGPWTRAAA    141 - 210
WWGRLEGAKASAKGEQVRDPGGHLWEQGHVSPCARFNQGHSCGSPKVSHTTWVS                    211 - 264
//

Text Mined References (4)

PMID Year Title