Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 8.7e-05
gastric carcinoma 832 1.8e-02

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 2.108 8.7e-05
gastric carcinoma -1.100 1.8e-02

Synonym

Accession Q8WZB0
Symbols NAG11
NAG12
C9orf130

 Compartment GO Term (0)

AA Sequence

MAANATSGRPPSIALRQPEATGWRRGIPAKVATKGTQAEREGDVRSGGRARGRCVRLAKRCSPSSLGLRR      1 - 70
RRRRTGGRQGDPQIFLGSDFRLLTPANSNPVLENPARTGSRIVIGISRERNLPFCGRSNLPDVSSL         71 - 136
//

Text Mined References (3)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.