Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.0e-36
adrenocortical carcinoma 1427 2.6e-09
pituitary cancer 1972 6.2e-03

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -4.500 2.6e-09
pituitary cancer -1.600 6.2e-03
psoriasis 3.000 2.0e-36

Synonym

Accession A8K010
Symbols C6orf176
bA142J11.1

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
22108211 C6orf176 as a potential biomarker and/or therapeutic target in context with diseases linked to deregulated cAMP signaling.

AA Sequence

MELSAAAGRRRQAPWREFTGRHRTERSQERGSTPRKERSMGSRQPRKREREPRDCTPTCTNAASVSRSGA      1 - 70
RRAPGCAGRCITMKNCARAWRELSERACCFQAVPPSNMKQSWLIFLDTTLCSAWLLASSCPRLYAPLISF     71 - 140
HCMCFNTVLLFPRLFGPTLSAKIQFNTDLSLRAIAWKCTKDTTTYC                            141 - 186
//

Text Mined References (5)

PMID Year Title
22108211 2012 C6orf176: a novel possible regulator of cAMP-mediated gene expression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.