Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.600 2.5e-05

 Compartment GO Term (0)

Pathway (1)

AA Sequence

MVRHPYSVQTQLSTEAKAIWRSMQQQETNLLANLTTNDARDNSKDFQNSKVGAAATSRDEGCNCPIIGEI      1 - 70
VISCYWLFEIPPLISE                                                           71 - 86
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11173868 2000 EST mining of the UniGene dataset to identify retina-specific genes.