Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P59037 Q3KNU0
Symbols C21orf84
NCRNA00313
CH507-42P11.5

 Compartment GO Term (0)

AA Sequence

MTTLSKSKQPSAAGNLDEQTPGECFCRSCFVTSSEVWKRWKHLDPACAADPWEAPTPRIEKPDGKECLGR      1 - 70
TSCPRLA                                                                    71 - 77
//

Text Mined References (5)

PMID Year Title