Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 5.2e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 5.2e-04

 Compartment GO Term (0)

AA Sequence

MYKSWTLGDPKEKEGVGNILEETKRTQNNTEQASRAINSPLQSPYTDSMKALAISSHWFLPQIHTLPPIT      1 - 70
KATRHRWPPACCGRRGGQTTLPPLTPIVRACESMERSCPGNYPMQHERKVMQRHPTLR                 71 - 128
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.