Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 4.0e-04
group 4 medulloblastoma -1.500 1.9e-03
medulloblastoma, large-cell -1.600 1.4e-04

AA Sequence

MLANDVRHQQEMWGFRKVEGGVVQSLGKSSVEGETDGTISEFREIQRLAAFASFLSHAPPLNARRLLTPP      1 - 70
PRRRPRCTPAAAMADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWRKRRLQDKLAATQKKLDLA       71 - 138
//

Text Mined References (4)

PMID Year Title