Property Summary

NCBI Gene PubMed Count 27
PubMed Score 79.33
PubTator Score 63.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 2.6e-05
medulloblastoma, large-cell 1.400 1.8e-04
Breast cancer 3.100 2.6e-02

Protein-protein Interaction (8)

Gene RIF (11)

PMID Text
24475316 LIN-9 phosphorylation on threonine-96 is required for transcriptional activation of LIN-9 target genes and promotes cell cycle progression.
24141769 Results show that E7 interacts with the B-Myb, FoxM1 and LIN9 components of this activator complex, leading to cooperative transcriptional activation of mitotic genes in primary cells and E7 recruitment to the corresponding promoters.
23381944 Study links hTRM9L and tRNA modifications to inhibition of tumour growth via LIN9 and HIF1-alpha-dependent mechanisms.
21860417 inactivation of LIN9, a subunit of DREAM, results in premature senescence, which can be overcome by the SV40 large T (LT) antigen
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360844 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17563750 The repressor complex that Mip/LIN-9 forms with p107 takes functional precedence over the transcriptional activation linked to the Mip/LIN-9 and B-Myb interaction.
17159899 human LIN-9, together with B-MYB, has a critical role in the activation of genes that are essential for progression into mitosis
17098733 Mip/LIN-9 is required for the expression of B-Myb, and both proteins collaborate in the control of the cell cycle progression via the regulation of S phase and cyclin A, cyclin B, and CDK1
16730350 Mutation of BARA/LIN-9 restores the expression of E2F target genes.
15538385 Human Lin-9 has tumor-suppressing activities and the ability of hLin-9 to inhibit transformation is mediated through its association with pRB.

AA Sequence

MAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDR      1 - 70
QINTRSPKRNQRVAMVPQKFTATMSTPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDN     71 - 140
DFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFK    141 - 210
DLPDEIPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETM    211 - 280
PIAAFGQKQRPSRFFMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTETLGGFPVEFLIQVTRLS    281 - 350
KILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQ    351 - 420
GLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKS    421 - 490
LTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAFAANNTNRD                      491 - 542
//

Text Mined References (35)

PMID Year Title
24475316 2014 LIN-9 phosphorylation on threonine-96 is required for transcriptional activation of LIN-9 target genes and promotes cell cycle progression.
24141769 2014 A functional interaction of E7 with B-Myb-MuvB complex promotes acute cooperative transcriptional activation of both S- and M-phase genes. (129 c).
23667535 2013 LIN9, a subunit of the DREAM complex, regulates mitotic gene expression and proliferation of embryonic stem cells.
23381944 2013 A human tRNA methyltransferase 9-like protein prevents tumour growth by regulating LIN9 and HIF1-?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22391450 2012 The MuvB complex sequentially recruits B-Myb and FoxM1 to promote mitotic gene expression.
22037783 2012 Prognostic impact of polymorphisms in the MYBL2 interacting genes in breast cancer.
21860417 2012 Loss of LIN9, a member of the DREAM complex, cooperates with SV40 large T antigen to induce genomic instability and anchorage-independent growth.
21498570 2011 DYRK1A protein kinase promotes quiescence and senescence through DREAM complex assembly.
21480327 2011 Activation of v-Myb avian myeloblastosis viral oncogene homolog-like2 (MYBL2)-LIN9 complex contributes to human hepatocarcinogenesis and identifies a subset of hepatocellular carcinoma with mutant p53.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360844 2010 Genome-wide association study identifies GPC5 as a novel genetic locus protective against sudden cardiac arrest.
20101237 2010 ARF-induced downregulation of Mip130/LIN-9 protein levels mediates a positive feedback that leads to increased expression of p16Ink4a and p19Arf.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19619530 2009 Deletion of the p107/p130-binding domain of Mip130/LIN-9 bypasses the requirement for CDK4 activity for the dissociation of Mip130/LIN-9 from p107/p130-E2F4 complex.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17671431 2007 LINC, a human complex that is related to pRB-containing complexes in invertebrates regulates the expression of G2/M genes.
17618148 Mip/LIN-9 can inhibit cell proliferation independent of the pocket proteins.
17563750 2007 Mammalian Mip/LIN-9 interacts with either the p107, p130/E2F4 repressor complex or B-Myb in a cell cycle-phase-dependent context distinct from the Drosophila dREAM complex.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
17159899 2007 The human synMuv-like protein LIN-9 is required for transcription of G2/M genes and for entry into mitosis.
17098733 2007 Mip/LIN-9 regulates the expression of B-Myb and the induction of cyclin A, cyclin B, and CDK1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16730350 2006 A mutant allele of BARA/LIN-9 rescues the cdk4-/- phenotype by releasing the repression on E2F-regulated genes.
15538385 2004 Inhibition of oncogenic transformation by mammalian Lin-9, a pRB-associated protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076766 2000 Transcription of meiotic cell cycle and terminal differentiation genes depends on a conserved chromatin associated protein, whose nuclear localisation is regulated.