Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.00
PubTator Score 4.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.900 2.4e-06
astrocytic glioma -1.600 6.9e-03
Astrocytoma, Pilocytic -1.300 1.9e-06
atypical teratoid / rhabdoid tumor -2.200 8.2e-09
ependymoma -1.900 9.5e-03
glioblastoma -1.500 7.6e-07
medulloblastoma -1.100 8.5e-03
medulloblastoma, large-cell -2.100 2.5e-05
oligodendroglioma -1.500 2.1e-02

Gene RIF (7)

AA Sequence

MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIR      1 - 70
AHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQL     71 - 140
LSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSYSSLESRG       141 - 207
//

Text Mined References (20)

PMID Year Title