Property Summary

NCBI Gene PubMed Count 26
PubMed Score 51.15
PubTator Score 25.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
pancreatic cancer 1.100 1.4e-02
malignant mesothelioma -1.500 1.8e-04
astrocytic glioma -1.800 3.2e-02
osteosarcoma -3.629 2.0e-04
ependymoma -1.400 3.3e-04
glioblastoma -2.400 1.2e-03
group 4 medulloblastoma -3.300 1.8e-06
cystic fibrosis 1.750 4.7e-06
atypical teratoid / rhabdoid tumor -3.800 1.6e-06
medulloblastoma, large-cell -4.100 4.0e-05
primitive neuroectodermal tumor -1.200 4.5e-02
pancreatic ductal adenocarcinoma liver m... -1.880 1.3e-03
non-small cell lung cancer -1.994 2.4e-20
intraductal papillary-mucinous adenoma (... -2.100 1.4e-04
intraductal papillary-mucinous carcinoma... -2.100 1.4e-04
intraductal papillary-mucinous neoplasm ... -2.200 1.9e-03
colon cancer -1.400 3.1e-02
lung cancer 2.800 4.8e-06
active Crohn's disease -1.615 3.5e-03
active ulcerative colitis -1.698 2.8e-03
lung adenocarcinoma -2.200 7.9e-24
pediatric high grade glioma -1.900 1.5e-03
pilocytic astrocytoma -1.300 1.5e-03
non primary Sjogren syndrome sicca -1.200 1.9e-02
pancreatic carcinoma 1.100 1.4e-02
lung carcinoma -1.900 4.9e-20
Breast cancer -1.300 6.8e-03
ovarian cancer -1.900 2.4e-14
pituitary cancer -2.600 7.7e-06

 GO Function (1)

Gene RIF (6)

PMID Text
26887652 This study therefore shows that LIN7A has a crucial role in the polarity abnormalities associated with breast carcinogenesis.
24658322 LIN7A depletion disrupts cerebral cortex development, contributing to intellectual disability in 12q21-deletion syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18286632 Allelic and haplotype association was found between both BDNF and adult ADHD, and LIN-7 and adult ADHD.
17237226 LIN7A is a PDZ protein that interacts with human papillomavirus-16 E6 and forms a tripartite complex with MPP7 and DLG1, regulating the stability and localization of DLG1 to cell junctions.
12110687 coordinated folding and association of the LIN-2, -7 domain

AA Sequence

MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQ      1 - 70
YMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPG     71 - 140
GVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQ    141 - 210
QQQLLIQQQQQQQQQQTQQNHMS                                                   211 - 233
//

Text Mined References (28)

PMID Year Title
26887652 2016 LIN7A is a major determinant of cell-polarity defects in breast carcinomas.
25416956 2014 A proteome-scale map of the human interactome network.
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
24658322 2014 LIN7A depletion disrupts cerebral cortex development, contributing to intellectual disability in 12q21-deletion syndrome.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18286632 2008 Association study of brain-derived neurotrophic factor (BDNF) and LIN-7 homolog (LIN-7) genes with adult attention-deficit/hyperactivity disorder.
17237226 2007 The stardust family protein MPP7 forms a tripartite complex with LIN7 and DLG1 that regulates the stability and localization of DLG1 to cell junctions.
16855024 2006 TIP-1 has PDZ scaffold antagonist activity.
16688213 2006 Cell fate-specific regulation of EGF receptor trafficking during Caenorhabditis elegans vulval development.
16192278 2005 Functional comparison between secretory pathway Ca2+/Mn2+-ATPase (SPCA) 1 and sarcoplasmic reticulum Ca2+-ATPase (SERCA) 1 isoforms by steady-state and transient kinetic analyses.
15494546 2005 Differential localization of mammalian Lin-7 (MALS/Veli) PDZ proteins in the kidney.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15024025 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins.
14960569 2004 A multiprotein trafficking complex composed of SAP97, CASK, Veli, and Mint1 is associated with inward rectifier Kir2 potassium channels.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14596909 2003 MALS is a binding partner of IRSp53 at cell-cell contacts.
12967566 2003 Polar expression of ErbB-2/HER2 in epithelia. Bimodal regulation by Lin-7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110687 2002 Coordinated folding and association of the LIN-2, -7 (L27) domain. An obligate heterodimerization involved in assembly of signaling and cell polarity complexes.
11311936 2001 VAM-1: a new member of the MAGUK family binds to human Veli-1 through a conserved domain.
10753959 2000 Molecular cloning and characterization of Pals, proteins associated with mLin-7.
10341223 1999 Characterization of MALS/Velis-1, -2, and -3: a family of mammalian LIN-7 homologs enriched at brain synapses in association with the postsynaptic density-95/NMDA receptor postsynaptic complex.
10228153 1999 PDZ-mediated interactions retain the epithelial GABA transporter on the basolateral surface of polarized epithelial cells.
9753324 1998 A tripartite protein complex with the potential to couple synaptic vesicle exocytosis to cell adhesion in brain.
9482110 1998 The C-terminus of the HTLV-1 Tax oncoprotein mediates interaction with the PDZ domain of cellular proteins.