Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.87
PubTator Score 1.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1963 1.2e-05
osteosarcoma 7766 6.9e-05
ovarian cancer 8297 8.4e-03
Disease Target Count Z-score Confidence
Retinoblastoma 18 3.107 1.6
Pleural empyema 12 3.048 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.642 6.9e-05
ovarian cancer 1.400 8.4e-03
tuberculosis -1.100 1.2e-05

Synonym

Accession Q52LA3
Symbols C14orf46
c14_5549

Gene

PDB

4YOO  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLK      1 - 70
ELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPKK                             71 - 116
//

Text Mined References (15)

PMID Year Title