Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.53
PubTator Score 0.54

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 6.0e-06
Disease Target Count Z-score Confidence
Central pontine myelinolysis 5 4.022 2.0


  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 6.0e-06


Accession Q96GY3 A8KAQ1 O14557 Q7Z2T9
Symbols F25965


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ                                      211 - 246

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21498570 2011 DYRK1A protein kinase promotes quiescence and senescence through DREAM complex assembly.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17671431 2007 LINC, a human complex that is related to pRB-containing complexes in invertebrates regulates the expression of G2/M genes.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.