Property Summary

NCBI Gene PubMed Count 96
PubMed Score 244.24
PubTator Score 210.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 7.000 3.3e-10
cystic fibrosis -1.008 5.3e-05
diabetes mellitus 1.400 1.1e-03
atypical teratoid/rhabdoid tumor 1.100 2.9e-02
ovarian cancer -1.400 3.1e-07

 GWAS Trait (1)

Gene RIF (83)

PMID Text
26945970 The role of Lin28 in cancer and immunity. [Review]
26714839 Our findings suggest that Lin28 plays a key role in the acquisition of resistance to AR-targeted therapies by prostate cancer cells and establish the importance of Lin28 in prostate cancer progression.
26675483 Erythroid-Specific Expression of LIN28A Is Sufficient for Robust Gamma-Globin Gene and Protein Expression in Adult Erythroblasts.
26583126 high LIN28 expressing ovarian cancer cells secrete exosomes that can be taken up by nontumor cells and cause changes in gene expression and cell behavior associated with tumor development. IGROV1
26494358 data document the expression profiles of the Lin28/let-7 system in rat testis along postnatal/pubertal maturation, and their perturbation in models of pubertal and hormonal manipulation
26149387 LIN28 may regulate splicing and gene expression programs that drive breast cancer subtype phenotypes.
26045559 Incubation of a embryonal carcinoma cell line with N-methyl-mesoporphyrin IX reduces its stem cell traits. In particular it decreases OCT4, HMGA1, CCNB1, CDK4, and Lin28A protein, decreases sphere formation, and inhibits colony formation.
25956904 detected aberrant expression of LIN28A and/or LIN28B in 38% of a large series of human CRC samples (n = 595), where LIN28 expression levels were associated with invasive tumor growth
25748578 Intraocular medulloepitheliomas and embryonal tumors with multilayered rosettes of the brain both display LIN28A positivity. Only the latter, however, display amplification of the 19q13.42 locus involving C19MC
25638158 Data implicate LIN28/RAS/MAP kinase as key drivers of tumorigenesis atypical teratoid rhabdoid tumors.
25515921 overexpression of Lin28 can suppress the biological behavior of gastric cancer in vitro, and let-7 miRNA may play an important role in the process
25479749 methylation modulates pluripotency in embryonic stem cells
25457611 Trim25 binds to the conserved terminal loop (CTL) of pre-let-7 and activates TuT4, allowing for more efficient Lin28a-mediated uridylation.
25415050 DFMO treatment restores balance to the LIN28/Let-7 axis and inhibits glycolytic metabolism and neurosphere formation in neuroblastoma
25301052 Lin28A and Lin28B enhance, whereas let-7 suppresses, aerobic glycolysis via targeting pyruvate dehydrogenase kinase 1, or PDK1.
25200669 LIN28 and its regulatory microRNAs have roles in adult adrenocortical cancer
25188417 LIN28A over-expression increased HbF, reduced beta (sickle)-globin, and strongly suppressed all members of the let-7 family of miRNAs while reducing erythrocyte sickling.
25128063 High Lin28 expression is associated with gastric cancer.
24970027 Results show the expression of Lin28 closely associated with resistance to paclitaxel in Hep3B cells which expresses high levels of Lin28. Its dysregulation inhibited let-7 family microRNA levels and upregulated the Bcl-xL, which is a target of let-7.
24942926 Expression of SUMO1/2/3 is dramatically enhanced by interferons through an miRNA-based mechanism involving the Lin28/let-7.
24860167 The results have demonstrated that LIN28 is a key translational determinant of the initiation of human embryonic stem cell differentiation.
24475120 High LIN28 expression was an independent prognostic factor for a shorter survival in glioblastoma multiforme patients.
24356103 Results highlight a novel molecular interaction between miR-125b and Lin28 in glioblastoma stem cells.
24349438 Lin28 induced EMT in breast cancer cells via downregulation of let-7a.
24311633 High LIN28 expression is associated with embryonal tumor with multilayered rosettes.
24006280 Data suggest that LIN28A plays functional role in regulating trophoblast differentiation/placentation; loss of LIN28A in human trophoblasts is sufficient to induce differentiation, but loss of Lin28a does not induce mouse trophoblast differentiation.
23884650 Data indicate that SOX2 regulates the LIN28/let-7 pathway in neural precursor cells (NPCs).
23846349 Data suggest a role for LIN28A in high grade gliomas and illustrate an HMGA2-associated, pro-invasive program that can be activated in GBM by LIN28A-mediated suppression of let-7 microRNAs.
23840685 Lin28 might be one mechanism underlying radiation resistance in breast cancer cells.
23790802 Findings demonstrate a novel role for Lin28 in prostate cancer development and activation of the androgen receptor axis.
23774216 We conclude that the LIN28/let-7 pathway has a critical pathobiologic role in malignant germ cell tumors
23728999 data demonstrate the involvement of a novel regulatory circuit consisting of miR-370, LIN28A, RelA/p65 and IL-6 in HCC progression.
23660113 The rs3811463 polymorphism in the let-7/Lin28 pathway could significantly increase the risk of type 2 diabetes mellitus.
23613467 The Wnt1-beta-catenin pathway represses let-7 microRNA expression through transactivation of Lin28 to augment breast cancer stem cell expansion.
23500413 Lin28a is an appropriate cancer stem cell target molecule for oral squamous cell carcinoma treatment.
23481595 Overexpression and knockdown of LIN28 followed by global profiling of mRNA and protein abundance showed that LIN28 protein stabilized its target RNAs with a concomitant increase in protein levels
23318446 Lin28A/Lin28B serves as key driver genes in Hepatitis B virus X protein-induced hepatocarcinogenesis
23307247 an independent public expression profiling data showed signature for Oct4, Lin28 and Nanog could successfully be used to predict the survival of colorectal cancer patients
23292830 Our results indicate that Lin28 was expressed in both gastric carcinoma and corresponding normal tissues. Lin28 protein positive expression served as an independent prognostic factor
23255092 The Lin-28 protein is mediated Bone Morphogenetic Protein 4 activation in the poor prognosis observed in a subpopulation of ovarian cancer patients expressing high levels of both Lin28 and Oct4.
23161096 LIN28A immunohistochemistry as a highly sensitive and specific, rapid, inexpensive diagnostic tool for routine pathological verification of embryonal tumor with multilayered rosettes.
23079661 show that MLL fusion proteins negatively regulate production of miR-150, an miRNA widely repressed in acute leukemia, by blocking miR-150 precursors from being processed to mature miRNAs through MYC/LIN28 functional axis
22959275 These findings identify important regulatory functions of LIN28 via direct mRNA interactions.
22935707 A subset of Lin28 mRNA targets are destabilized in a Drosha-dependent manner.
22898984 Lin28 uses two different TUTases to control let-7 expression.
22808086 Overexpression of Lin28 in breast cancer cells considerably induced p21 and Rb expression and inhibited Let-7 miRNA levels.
22713243 Lin28 stimulates HER2 expression at the posttranscriptional level, and that enforced Lin28 expression promotes cancer cell growth via multiple mechanisms.
22689537 LIN28 is expressed only in a very small subpopulation of spermatogonia in the adult monkey and human testis
22545159 LIN28 is a predicted target of miR-125b in differentiating human embryonic stem cells.
22532168 findings therefore show a critical role for the REST-LIN28A axis in tumor aggression and suggest a causative relationship between REST loss and tumorigenicity in vivo
22467868 Lin-28 homologue A (LIN28A) promotes cell cycle progression via regulation of cyclin-dependent kinase 2 (CDK2), cyclin D1 (CCND1), and cell division cycle 25 homolog A (CDC25A) expression in cancer.
22433967 High expression of Lin28 is associated with poor prognosis and high tumour aggressiveness in oesophageal cancer and these effects are mediated through increased proliferation and invasiveness of oesophageal cancer cells.
22429493 that LIN28 was a negative independent predictor for both overall survival and recurrence-free survival in hepatocellular carcinoma patients who met the Milan criteria. LIN28 was expressed at a higher frequency in tumor tissues than in non-HCC tissues.
22296229 LIN28 expression is germ cell specific and becomes restricted to a subpopulation of germ cells with increasing gestation in the fetal ovary.
22263265 Both HeLaS3/pAAV2neo-Lin28a and HeLaS3/pAAV2neo-Lin28b could express Lin28a and Lin28b effectively.
22240064 LIN28A is strongly expressed in germ cells during early human ovary development, but disruption of LIN28Ais not a common cause of primary ovarian insufficiency.
22210895 Lin28 mRNA contains ARE within its 3'-UTR and TTP enhances the decay of Lin28 mRNA through binding to its 3'-UTR.
22162396 L1TD1 is part of the L1TD1-RHA-LIN28 complex that could influence levels of OCT4, suggesting that L1TD1 has an important role in the regulation of stemness.
22157959 Data show that the zinc knuckle domains of Lin28 are sufficient to provide binding selectivity for pre-let-7 miRNAs.
22118463 Lin28A recruits a TUTase (Zcchc11/TUT4) to let-7 precursors to block processing by Dicer in the cell cytoplasm.
22081076 These results suggest the possible involvement of LIN28 in regulation of sex steroid dependent cell proliferation of breast carcinoma cells.
22034885 LIN28 is a sensitive marker for ovarian germ cell tumours
21979467 let-7 and Lin28 have contrary roles in megakaryocytic (MK) differentiation with a dynamic balance
21912531 this study demonstrates that host genetic variants could disturb the regulation of the let-7/LIN28 double-negative feedback loop and alter breast cancer risk.
21815640 A conformational change in LIN28 binding is determined that results in the unwinding of an otherwise double-stranded region at the Dicer processing site of pre-let-7g microRNA.
21631526 LIN28 regulates the differentiation status of seminoma and embryonal carcinoma and is likely to play a related role in normal human germ-cell development.
21553022 induction of Lin-28 could mediate repression of let-7 family members, promote cell cycle progression and suppress cell proliferation
21425412 Lin28, working in concert with RNA Helicase A, enhances the translation of genes important for the growth and survival of human embryonic stem cells.
21417895 Of the 16 malignant rhabdoid tumors, 14 (88%) tumors showed robust SALL4 and/or LIN28 expression.
21057460 For primary extragonadal yolk sac tumors, combining LIN28 and SALL4 can achieve a higher diagnostic sensitivity than either alone.
21045151 Data suggest that A rebalancing of the LIN28/let-7 regulatory loop could be a novel therapeutic strategy to target ALDH1+ cancer stem cells.
20947512 miRNAs let-7, mir-125, mir-9, and mir-30 directly repress LIN28 expression in embryonic stem and cancer cells
20101213 Lin28 and Oct4 may have important roles in the initiation and/or progression of epithelial ovarian cancer.
19966271 Results suggest a role for Lin28 in the regulation of Oct4 translation.
19878981 Src activates an inflammatory signal, and epigenetic inheritance is mediated by a positive feedback loop involving the NF-kappaB transcription factor, Lin28, Let-7 microRNA, and IL6; this regulatory circuit links inflammation to cellular transformation.
19703396 This study uncovers the role of TUT4 and Lin28 as specific suppressors of microRNA biogenesis, which has implications for stem cell research and cancer biology.
19578360 overexpression of Lin28 is associated with human germ-cell tumors
19483683 Study shows that LIN28 and LIN28B are overexpressed in primary human tumors and human cancer cell lines (overall frequency approximately 15%), and that overexpression is linked to repression of let-7 family miRNAs and derepression of let-7 targets.
19153603 Raf kinase inhibitory protein suppresses a metastasis signalling cascade involving LIN28 and let-7
19038789 LIN-28 does not seem to be involved in the self-renewal of human embryonic stem cells, but rather seems to be involved in their decision to switch from self-renewal to differentiation.
18550544 analysis of let-7g microRNA processing inhibition by the developmentally regulated RNA-binding protein Lin28
16227573 Lin-28 downregulation by miR-125 involves reductions in both translational efficiency and mRNA abundance.
12798299 microRNA regulation is a conserved feature of the Lin-28 gene in diverse animals.

AA Sequence

MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPV      1 - 70
DVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCY     71 - 140
NCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN     141 - 209
//

Text Mined References (98)

PMID Year Title
26945970 2016 RNA-binding protein Lin28 in cancer and immunity.
26714839 2016 Lin28 induces resistance to anti-androgens via promotion of AR splice variant generation.
26675483 2015 Erythroid-Specific Expression of LIN28A Is Sufficient for Robust Gamma-Globin Gene and Protein Expression in Adult Erythroblasts.
26583126 2015 High LIN28A Expressing Ovarian Cancer Cells Secrete Exosomes That Induce Invasion and Migration in HEK293 Cells.
26494358 2015 Testicular expression of the Lin28/let-7 system: Hormonal regulation and changes during postnatal maturation and after manipulations of puberty.
26149387 2015 LIN28A Modulates Splicing and Gene Expression Programs in Breast Cancer Cells.
26045559 2015 An RNA-binding Protein, Lin28, Recognizes and Remodels G-quartets in the MicroRNAs (miRNAs) and mRNAs It Regulates.
25956904 2015 LIN28 cooperates with WNT signaling to drive invasive intestinal and colorectal adenocarcinoma in mice and humans.
25748578 2015 Intraocular Medulloepitheliomas and Embryonal Tumors With Multilayered Rosettes of the Brain: Comparative Roles of LIN28A and C19MC.
25638158 2015 Disrupting LIN28 in atypical teratoid rhabdoid tumors reveals the importance of the mitogen activated protein kinase pathway as a therapeutic target.
25515921 2015 Overexpression of Lin28 inhibits the proliferation, migration and cell cycle progression and induces apoptosis of BGC-823 gastric cancer cells.
25479749 2014 SET7/9 methylation of the pluripotency factor LIN28A is a nucleolar localization mechanism that blocks let-7 biogenesis in human ESCs.
25457611 2014 Trim25 Is an RNA-Specific Activator of Lin28a/TuT4-Mediated Uridylation.
25415050 2015 Targeting ornithine decarboxylase reverses the LIN28/Let-7 axis and inhibits glycolytic metabolism in neuroblastoma.
25301052 2014 Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1.
25200669 2015 Expression of LIN28 and its regulatory microRNAs in adult adrenocortical cancer.
25188417 2014 LIN28A expression reduces sickling of cultured human erythrocytes.
25128063 2014 Lin28 promotes Her2 expression and Lin28/Her2 predicts poorer survival in gastric cancer.
24970027 2014 Lin28/let-7/Bcl-xL pathway: the underlying mechanism of drug resistance in Hep3B cells.
24942926 2014 Interferon controls SUMO availability via the Lin28 and let-7 axis to impede virus replication.
24860167 2014 Divergent LIN28-mRNA associations result in translational suppression upon the initiation of differentiation.
24475120 2014 LIN28 is involved in glioma carcinogenesis and predicts outcomes of glioblastoma multiforme patients.
24356103 2014 miR-125b promotes cell proliferation by directly targeting Lin28 in glioblastoma stem cells with low expression levels of miR-125b.
24349438 2013 Lin28 induces epithelial-to-mesenchymal transition and stemness via downregulation of let-7a in breast cancer cells.
24311633 2014 A novel C19MC amplified cell line links Lin28/let-7 to mTOR signaling in embryonal tumor with multilayered rosettes.
24006280 2013 Role of LIN28A in mouse and human trophoblast cell differentiation.
23884650 2013 SOX2-LIN28/let-7 pathway regulates proliferation and neurogenesis in neural precursors.
23846349 2013 LIN28A facilitates the transformation of human neural stem cells and promotes glioblastoma tumorigenesis through a pro-invasive genetic program.
23840685 2013 Lin28 mediates radiation resistance of breast cancer cells via regulation of caspase, H2A.X and Let-7 signaling.
23790802 2013 Lin28 promotes growth of prostate cancer cells and activates the androgen receptor.
23774216 2013 LIN28 Expression in malignant germ cell tumors downregulates let-7 and increases oncogene levels.
23728999 2013 Perturbation of MicroRNA-370/Lin-28 homolog A/nuclear factor kappa B regulatory circuit contributes to the development of hepatocellular carcinoma.
23660113 2013 The polymorphism in the let-7 targeted region of the Lin28 gene is associated with increased risk of type 2 diabetes mellitus.
23613467 2013 The Wnt-?-catenin pathway represses let-7 microRNA expression through transactivation of Lin28 to augment breast cancer stem cell expansion.
23500413 2013 Lin28a is a putative factor in regulating cancer stem cell-like properties in side population cells of oral squamous cell carcinoma.
23481595 2013 Identification of mRNAs bound and regulated by human LIN28 proteins and molecular requirements for RNA recognition.
23318446 2014 Hepatitis B virus X protein upregulates Lin28A/Lin28B through Sp-1/c-Myc to enhance the proliferation of hepatoma cells.
23307247 2013 A signature for induced pluripotent stem cell-associated genes in colorectal cancer.
23292830 2013 Positive expression of Lin28 is correlated with poor survival in gastric carcinoma.
23255092 2013 Lin28 regulates BMP4 and functions with Oct4 to affect ovarian tumor microenvironment.
23161096 2012 LIN28A immunoreactivity is a potent diagnostic marker of embryonal tumor with multilayered rosettes (ETMR).
23079661 2012 Blockade of miR-150 maturation by MLL-fusion/MYC/LIN-28 is required for MLL-associated leukemia.
22959275 2012 LIN28 binds messenger RNAs at GGAGA motifs and regulates splicing factor abundance.
22935707 2012 Drosha mediates destabilization of Lin28 mRNA targets.
22898984 2012 Lin28-mediated control of let-7 microRNA expression by alternative TUTases Zcchc11 (TUT4) and Zcchc6 (TUT7).
22808086 2012 Lin28 mediates paclitaxel resistance by modulating p21, Rb and Let-7a miRNA in breast cancer cells.
22713243 2012 Lin28 regulates HER2 and promotes malignancy through multiple mechanisms.
22689537 2012 The pluripotency factor LIN28 in monkey and human testes: a marker for spermatogonial stem cells?
22545159 2012 miR-125b promotes early germ layer specification through Lin28/let-7d and preferential differentiation of mesoderm in human embryonic stem cells.
22532168 2012 Induction of the RNA regulator LIN28A is required for the growth and pathogenesis of RESTless breast tumors.
22467868 2012 Lin-28 homologue A (LIN28A) promotes cell cycle progression via regulation of cyclin-dependent kinase 2 (CDK2), cyclin D1 (CCND1), and cell division cycle 25 homolog A (CDC25A) expression in cancer.
22433967 2012 High expression of Lin28 is associated with tumour aggressiveness and poor prognosis of patients in oesophagus cancer.
22429493 2012 LIN28 expression and prognostic value in hepatocellular carcinoma patients who meet the Milan criteria and undergo hepatectomy.
22296229 2012 LIN28 is selectively expressed by primordial and pre-meiotic germ cells in the human fetal ovary.
22263265 2011 [Effects of Lin28a and Lin28b on let-7 family activity].
22240064 2012 Analysis of LIN28A in early human ovary development and as a candidate gene for primary ovarian insufficiency.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22210895 2012 Ectopic over-expression of tristetraprolin in human cancer cells promotes biogenesis of let-7 by down-regulation of Lin28.
22162396 2012 RNA-binding protein L1TD1 interacts with LIN28 via RNA and is required for human embryonic stem cell self-renewal and cancer cell proliferation.
22157959 2011 Structural basis of pre-let-7 miRNA recognition by the zinc knuckles of pluripotency factor Lin28.
22118463 2011 Lin28A and Lin28B inhibit let-7 microRNA biogenesis by distinct mechanisms.
22081076 2012 LIN28: a regulator of tumor-suppressing activity of let-7 microRNA in human breast cancer.
22034885 2011 RNA-binding protein LIN28 is a sensitive marker of ovarian primitive germ cell tumours.
21979467 2012 MiR-181 mediates cell differentiation by interrupting the Lin28 and let-7 feedback circuit.
21912531 2011 Germline genetic variants disturbing the Let-7/LIN28 double-negative feedback loop alter breast cancer susceptibility.
21815640 2011 A LIN28-dependent structural change in pre-let-7g directly inhibits dicer processing.
21631526 2011 Expression and interdependencies of pluripotency factors LIN28, OCT3/4, NANOG and SOX2 in human testicular germ cells and tumours of the testis.
21553022 2011 Lin-28 reactivation is required for let-7 repression and proliferation in human small cell lung cancer cells.
21425412 2011 Genome-wide studies reveal that Lin28 enhances the translation of genes important for growth and survival of human embryonic stem cells.
21417895 Immunohistochemical expression of embryonic stem cell markers in malignant rhabdoid tumors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21057460 2011 RNA-binding protein LIN28 is a marker for primary extragonadal germ cell tumors: an immunohistochemical study of 131 cases.
21045151 2010 Double-negative feedback loop between reprogramming factor LIN28 and microRNA let-7 regulates aldehyde dehydrogenase 1-positive cancer stem cells.
20947512 2010 Identification of microRNAs regulating reprogramming factor LIN28 in embryonic stem cells and cancer cells.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20101213 2010 Pluripotency factors Lin28 and Oct4 identify a sub-population of stem cell-like cells in ovarian cancer.
20014101 2010 Mouse ZAR1-like (XM_359149) colocalizes with mRNA processing components and its dominant-negative mutant caused two-cell-stage embryonic arrest.
19966271 2010 Lin28-mediated post-transcriptional regulation of Oct4 expression in human embryonic stem cells.
19878981 2009 An epigenetic switch involving NF-kappaB, Lin28, Let-7 MicroRNA, and IL6 links inflammation to cell transformation.
19703396 2009 TUT4 in concert with Lin28 suppresses microRNA biogenesis through pre-microRNA uridylation.
19578360 2009 A role for Lin28 in primordial germ-cell development and germ-cell malignancy.
19483683 2009 Lin28 promotes transformation and is associated with advanced human malignancies.
19153603 2009 Raf kinase inhibitory protein suppresses a metastasis signalling cascade involving LIN28 and let-7.
19038789 2009 Genetic analysis of the role of the reprogramming gene LIN-28 in human embryonic stem cells.
18951094 2008 Lin28 mediates the terminal uridylation of let-7 precursor MicroRNA.
18604195 2008 A feedback loop comprising lin-28 and let-7 controls pre-let-7 maturation during neural stem-cell commitment.
18550544 2008 Determinants of microRNA processing inhibition by the developmentally regulated RNA-binding protein Lin28.
17617744 Localization of the developmental timing regulator Lin28 to mRNP complexes, P-bodies and stress granules.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16227573 2005 Micro-RNA regulation of the mammalian lin-28 gene during neuronal differentiation of embryonal carcinoma cells.
15722555 2005 Depletion of human micro-RNA miR-125b reveals that it is critical for the proliferation of differentiated cells but not for the down-regulation of putative targets during differentiation.
15614775 2005 Vascular gene expression and phenotypic correlation during differentiation of human embryonic stem cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15003116 2004 Expression profiling of mammalian microRNAs uncovers a subset of brain-expressed microRNAs with possible roles in murine and human neuronal differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688391 2004 The transcriptome profile of human embryonic stem cells as defined by SAGE.
12798299 2003 Conservation of the heterochronic regulator Lin-28, its developmental expression and microRNA complementary sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.