Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.89
PubTator Score 7.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 8.8e-08
cystic fibrosis -1.444 1.3e-05
non-small cell lung cancer -2.141 3.2e-29
lung cancer -1.200 5.2e-03
breast carcinoma -1.400 1.7e-05
lung adenocarcinoma -2.000 5.3e-13
non-inflammatory breast cancer -1.200 2.1e-02
ductal carcinoma in situ -1.400 1.3e-05
invasive ductal carcinoma -1.700 6.1e-05

Gene RIF (6)

PMID Text
25589244 Data indicate compound heterozygous missense mutations that are predicted to be pathogenic in LIM and senescent cell antigen-like domains 2 protein (LIMS2).
25346044 Results defined the functional role of copy number variations involving PINCH-2 in cancer progression based on the field cancerization effect; cell migration and invasion through autocrine and paracrine function as part of the field cancerization effect.
20500520 PINCH-2 mRNA is overexpressed in malignant mesothelioma
20237496 Observational study of gene-disease association. (HuGE Navigator)
16959213 LIMS2 may be useful as a molecular biomarker and a therapeutic target by increasing its expression and activity in gastric cancer
12167643 These results identify a novel nuclear and focal adhesion protein that associates with ILK and reveals an important role of PINCH-2 in the regulation of the PINCH-1-ILK interaction, cell shape change, and migration.

AA Sequence

MTGSNMSDALANAVCQRCQARFSPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCEHDFQM      1 - 70
LFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGRHLCRPCHNREKAKGLGKYIC     71 - 140
QRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEARELKGELYCLPCHDKMGVPICGACRRPIEGRVV    141 - 210
NALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSC    211 - 280
FSCSTCNSKLTLKNKFVEFDMKPVCKRCYEKFPLELKKRLKKLSELTSRKAQPKATDLNSA             281 - 341
//

Text Mined References (22)

PMID Year Title
25589244 2015 LIMS2 mutations are associated with a novel muscular dystrophy, severe cardiomyopathy and triangular tongues.
25416956 2014 A proteome-scale map of the human interactome network.
25346044 2015 PINCH-2 presents functional copy number variation and suppresses migration of colon cancer cells by paracrine activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20500520 2011 PINCH-2 expression in cancers involving serosal effusions using quantitative PCR.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19963065 2010 Structural basis of competition between PINCH1 and PINCH2 for binding to the ankyrin repeat domain of integrin-linked kinase.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18480182 2008 Roles of PINCH-2 in regulation of glomerular cell shape change and fibronectin matrix deposition.
17435276 2007 Molecular cloning and characterization of a novel splice variant of the LIM domain family gene, PINCH 2, in human testis.
16959213 2006 The epigenetic silencing of LIMS2 in gastric cancer and its inhibitory effect on cell migration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167643 2002 Characterization of PINCH-2, a new focal adhesion protein that regulates the PINCH-1-ILK interaction, cell spreading, and migration.
11331308 2001 A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading.